- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Rat Intestinal-Type Alkaline Phosphatase 1 (ALPI/IAP-1), Active |
| Catalog No. | IEC-HMM-0135 |
| Description | An active recombinant mature rat intestinal alkaline phosphatase covering residues 21-511, produced in mammalian cells with an N-terminal 10xHis tag. Enzyme activity is defined through p-nitrophenyl phosphate hydrolysis under alkaline conditions. |
| Intended Use | Suitable for alkaline phosphatase activity assays, enzyme characterization, substrate hydrolysis studies, assay development, and IVD raw-material research. |
| Principle / Technology | The mature rat ALPI enzyme is expressed in mammalian cells, purified, and quantified through hydrolysis of p-nitrophenyl phosphate at defined temperature and pH. |
| Detection Method | SDS-PAGE; enzymatic activity assay; LAL assay |
| Sample Type | Purified recombinant enzyme |
| Performance Range / Specifications | Purity: >=95% by SDS-PAGE. Specific activity: >10370.37 U/mg. Molecular weight: 55.9 kDa. Package sizes: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg. |
| Sensitivity / LOD | Specific activity: >10370.37 U/mg. |
| Specificity | Enzymatic activity was demonstrated with p-nitrophenyl phosphate as the substrate. |
| Reaction Conditions / Protocol | Measure p-nitrophenyl phosphate hydrolysis at 37 C and pH 10.0; one unit corresponds to cleavage of 1 nmol of substrate per minute. |
| Components / Formulation | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; specific activity established using a substrate hydrolysis assay. |
| Key Features | Active mature rat intestinal alkaline phosphatase; residues 21-511; N-terminal 10xHis tag; specific activity >10370.37 U/mg; low endotoxin. |
| Purity | >=95% by SDS-PAGE. |
| Activity / Unit Definition | One unit is the amount of enzyme required to cleave 1 nmol of p-nitrophenyl phosphate per minute at 37 C and pH 10.0. Specific activity is >10370.37 U/mg. |
| Molecular Weight | 55.9 kDa |
| Source / Origin | Rat protein produced in Mammalian cells. |
| pH Range / Optimal pH | Formulated at pH 8.0; activity unit defined at pH 10.0. |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for pNPP-based phosphatase assays, enzyme characterization, and alkaline phosphatase research workflows. |
| Recommended Buffer System | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Recognition Sequence / Cleavage Site | p-Nitrophenyl phosphate (pNPP) substrate |
| Alternative Names / Synonyms | Intestinal alkaline phosphatase 1; IAP-1; intestinal alkaline phosphatase I; IAP-I |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Rat |
| Tag Information | N-terminal 10xHis tag |
| Amino Acid Sequence | VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN |
| UniProt Accession | P15693 |
| Protein Length | 491 aa |
| Expression Region | 21-511 aa |
| Endotoxin Level | <1.0 EU/ug by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
