- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Leukemia Inhibitory Factor (LIF), Mature Protein, Active |
| Catalog No. | PTR-HMM-0220 |
| Description | A recombinant mature human LIF protein spanning residues 23-202, produced in mammalian cells with a C-terminal human Fc1 tag. Receptor-binding activity was confirmed by functional ELISA. |
| Intended Use | Suitable for functional ELISA, LIF receptor-binding studies, cytokine signaling research, and related cell biology applications. |
| Principle / Technology | A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays. |
| Detection Method | SDS-PAGE; functional ELISA; LAL assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=90% by SDS-PAGE. Molecular weight: 48.6 kDa. Package sizes: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg. |
| Sensitivity / LOD | Functional ELISA EC50: 22.58-30.24 ng/mL for binding to human LIF receptor. |
| Specificity | Binding activity was demonstrated with human LIF receptor. |
| Reaction Conditions / Protocol | In a functional ELISA, immobilized human LIF at 2 ug/mL bound human LIF receptor, with an EC50 of 22.58-30.24 ng/mL. |
| Components / Formulation | PBS, 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity verified by functional ELISA. |
| Key Features | Active mature human LIF; 23-202 aa; C-terminal human Fc1 tag; mammalian cell expression. |
| Purity | >=90% by SDS-PAGE. |
| Activity / Unit Definition | In a functional ELISA, immobilized human LIF at 2 ug/mL bound human LIF receptor, with an EC50 of 22.58-30.24 ng/mL. |
| Molecular Weight | 48.6 kDa |
| Source / Origin | Human protein produced in mammalian cells. |
| pH Range / Optimal pH | pH 7.4 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA and human LIF receptor-binding studies. |
| Recommended Buffer System | PBS, 6% trehalose, pH 7.4 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | Differentiation-stimulating factor; D factor; Melanoma-derived LPL inhibitor; MLPLI; Emfilermin |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal human Fc1 tag |
| Amino Acid Sequence | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF |
| UniProt Accession | P15018 |
| Protein Length | 180 aa |
| Expression Region | 23-202 aa |
| Endotoxin Level | <1.0 EU/ug by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
