- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Interleukin-3 (IL-3), Active |
| Catalog No. | PTR-HMM-0144 |
| Description | An active recombinant human IL3 construct representing the full-length mature protein (20-152 aa) and produced in E. coli. The protein carries a C-terminal 6×His tag and is supplied for research use. |
| Intended Use | For research use in tF-1 cell proliferation assays; cytokine-response studies. |
| Principle / Technology | Recombinant expression in E. coli, followed by purification and functional qualification with sDS-PAGE; TF-1 cell proliferation assay. |
| Detection Method | SDS-PAGE; TF-1 cell proliferation assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | ≥95% by SDS-PAGE; molecular weight 22.0 kDa; package options: 20 µg; 100 µg; 1 mg. |
| Sensitivity / LOD | ED50 5.972-17.16 ng/mL in a TF-1 proliferation assay. |
| Specificity | Promotes proliferation of IL-3-responsive TF-1 cells. |
| Reaction Conditions / Protocol | Briefly centrifuge the vial before opening, then reconstitute with sterile deionized water to 0.1-1.0 mg/mL. |
| Components / Formulation | PBS containing 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20°C or -80°C. Prepare working aliquots after opening or reconstitution and avoid repeated freeze-thaw cycles. |
| Shelf Life | Lyophilized material: up to 12 months at -20°C to -80°C. |
| Package Specifications | 20 µg; 100 µg; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity assessed by SDS-PAGE; functional performance verified in the stated bioassay; endotoxin level <1.0 EU/µg. |
| Key Features | Functionally tested active protein; defined 20-152 aa construct; C-terminal 6×His tag; ≥95% by SDS-PAGE. |
| Purity | ≥95% by SDS-PAGE |
| Activity / Unit Definition | Biological activity was confirmed in a TF-1 cell proliferation assay with an ED50 of 5.972-17.16 ng/mL. |
| Molecular Weight | 22.0 kDa |
| Source / Origin | Human protein produced in E. coli. |
| pH Range / Optimal pH | pH 7.4 |
| Expiration Date / Stability | Lyophilized material: up to 12 months at -20°C to -80°C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | TF-1 cell proliferation assays; cytokine-response studies |
| Recommended Buffer System | PBS containing 6% trehalose, pH 7.4 |
| Application Notes / Precautions | After reconstitution, keep a working aliquot at 4°C for no longer than one week. For longer storage, prepare aliquots and avoid repeated freeze-thaw cycles. |
| Alternative Names / Synonyms | Interleukin-3; IL-3; hematopoietic growth factor; mast cell growth factor; multipotential colony-stimulating factor |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal 6×His tag |
| Amino Acid Sequence | APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF |
| UniProt Accession | P08700 |
| Protein Length | 133 amino acids |
| Expression Region | 20-152 aa |
| Endotoxin Level | <1.0 EU/µg |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
