- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Inactive Tyrosine-Protein Kinase Transmembrane Receptor ROR1, Partial, Active |
| Catalog No. | PTR-HMM-0247 |
| Description | A recombinant human ROR1 protein covering residues 30-403, produced in Mammalian cells with C-terminal 10xHis tag. Biological activity was verified using the listed assay. |
| Intended Use | Suitable for functional ELISA, affinity studies, ROR1 antibody research, oncology research, and assay development. |
| Principle / Technology | A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays. |
| Detection Method | SDS-PAGE; SEC-HPLC; functional ELISA; surface plasmon resonance; LAL assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=95% by SDS-PAGE and >=90% by SEC-HPLC.. Molecular weight: 44.8 kDa. Package sizes: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg. |
| Sensitivity / LOD | In a functional ELISA, immobilized ROR1 at 2 ug/mL bound a ROR1-specific antibody with an EC50 of 0.2450-0.3416 ng/mL. Surface plasmon resonance analysis measured an affinity constant of 0.305 nM. |
| Specificity | Binding activity was demonstrated with a ROR1-specific recombinant monoclonal antibody. |
| Reaction Conditions / Protocol | In a functional ELISA, immobilized ROR1 at 2 ug/mL bound a ROR1-specific antibody with an EC50 of 0.2450-0.3416 ng/mL. Surface plasmon resonance analysis measured an affinity constant of 0.305 nM. |
| Components / Formulation | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by sds-page; purity evaluated by sec-hplc; endotoxin tested by lal assay; biological activity verified by functional elisa. |
| Key Features | Active recombinant human protein; 30-403 aa; C-terminal 10xHis tag; Mammalian cells expression. |
| Purity | >=95% by SDS-PAGE and >=90% by SEC-HPLC. |
| Activity / Unit Definition | In a functional ELISA, immobilized ROR1 at 2 ug/mL bound a ROR1-specific antibody with an EC50 of 0.2450-0.3416 ng/mL. Surface plasmon resonance analysis measured an affinity constant of 0.305 nM. |
| Molecular Weight | 44.8 kDa |
| Source / Origin | Human protein produced in Mammalian cells. |
| pH Range / Optimal pH | pH 8.0 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA, affinity studies, ROR1 antibody research, oncology research, and assay development. |
| Recommended Buffer System | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | Neurotrophic tyrosine kinase receptor-related 1 |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal 10xHis tag |
| Amino Acid Sequence | QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME |
| UniProt Accession | Q01973 |
| Protein Length | 374 aa |
| Expression Region | 30-403 aa |
| Endotoxin Level | <1.0 EU/ug by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |