Recombinant Human Inactive Tyrosine-Protein Kinase Transmembrane Receptor ROR1, Partial, Active
Research
Online Inquiry

Recombinant Human Inactive Tyrosine-Protein Kinase Transmembrane Receptor ROR1, Partial, Active

Cat.No: PTR-HMM-0247 Datasheet

Quantities:
- +
Product Details Related Products
Product Name Recombinant Human Inactive Tyrosine-Protein Kinase Transmembrane Receptor ROR1, Partial, Active
Catalog No. PTR-HMM-0247
Description A recombinant human ROR1 protein covering residues 30-403, produced in Mammalian cells with C-terminal 10xHis tag. Biological activity was verified using the listed assay.
Intended Use Suitable for functional ELISA, affinity studies, ROR1 antibody research, oncology research, and assay development.
Principle / Technology A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays.
Detection Method SDS-PAGE; SEC-HPLC; functional ELISA; surface plasmon resonance; LAL assay
Sample Type Purified recombinant protein
Performance Range / Specifications Purity: >=95% by SDS-PAGE and >=90% by SEC-HPLC.. Molecular weight: 44.8 kDa. Package sizes: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg.
Sensitivity / LOD In a functional ELISA, immobilized ROR1 at 2 ug/mL bound a ROR1-specific antibody with an EC50 of 0.2450-0.3416 ng/mL. Surface plasmon resonance analysis measured an affinity constant of 0.305 nM.
Specificity Binding activity was demonstrated with a ROR1-specific recombinant monoclonal antibody.
Reaction Conditions / Protocol In a functional ELISA, immobilized ROR1 at 2 ug/mL bound a ROR1-specific antibody with an EC50 of 0.2450-0.3416 ng/mL. Surface plasmon resonance analysis measured an affinity constant of 0.305 nM.
Components / Formulation 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0
Storage Conditions Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles.
Shelf Life Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Package Specifications 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg
Product Form Lyophilized powder
Quality Control Purity evaluated by sds-page; purity evaluated by sec-hplc; endotoxin tested by lal assay; biological activity verified by functional elisa.
Key Features Active recombinant human protein; 30-403 aa; C-terminal 10xHis tag; Mammalian cells expression.
Purity >=95% by SDS-PAGE and >=90% by SEC-HPLC.
Activity / Unit Definition In a functional ELISA, immobilized ROR1 at 2 ug/mL bound a ROR1-specific antibody with an EC50 of 0.2450-0.3416 ng/mL. Surface plasmon resonance analysis measured an affinity constant of 0.305 nM.
Molecular Weight 44.8 kDa
Source / Origin Human protein produced in Mammalian cells.
pH Range / Optimal pH pH 8.0
Expiration Date / Stability Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Regulatory / Compliance For research use only; not for clinical diagnosis or treatment.
Compatibility Suitable for functional ELISA, affinity studies, ROR1 antibody research, oncology research, and assay development.
Recommended Buffer System 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0
Application Notes / Precautions Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week.
Alternative Names / Synonyms Neurotrophic tyrosine kinase receptor-related 1
Lead Time 3-7 business days
Availability Status In Stock
Host Species Human
Tag Information C-terminal 10xHis tag
Amino Acid Sequence QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME
UniProt Accession Q01973
Protein Length 374 aa
Expression Region 30-403 aa
Endotoxin Level <1.0 EU/ug by the LAL method.

For research use only, not for clinical use.

0
0

There is no product in your cart.