Recombinant Cynomolgus Monkey Delta-Like Protein 3 (DLL3), Partial, Active

Name: Recombinant Cynomolgus Monkey Delta-Like Protein 3 (DLL3), Partial, Active
Price: Contact Alta DiagnoTech for price USD
Availability: InStock

Cat.No: PTR-HMM-0223 Datasheet

Quantities:

- +

Add To Cart

Product Details Related Products

Product Name	Recombinant Cynomolgus Monkey Delta-Like Protein 3 (DLL3), Partial, Active
Catalog No.	PTR-HMM-0223
Description	A recombinant cynomolgus monkey DLL3 extracellular region spanning residues 27-490, produced in mammalian cells with a C-terminal 6xHis tag. Antibody-binding activity was confirmed by functional ELISA.
Intended Use	Suitable for functional ELISA, antibody-binding studies, cross-reactivity assessment, and DLL3-targeted research.
Principle / Technology	A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays.
Detection Method	SDS-PAGE; functional ELISA; LAL assay
Sample Type	Purified recombinant protein
Performance Range / Specifications	Purity: >=85% by SDS-PAGE. Molecular weight: 50.6 kDa. Package sizes: 20 ug; 100 ug; 1 mg.
Sensitivity / LOD	Functional ELISA EC50: 1.625-2.702 ng/mL for binding to an anti-DLL3 recombinant antibody.
Specificity	Binding activity was demonstrated with an anti-DLL3 recombinant antibody.
Reaction Conditions / Protocol	In a functional ELISA, immobilized cynomolgus monkey DLL3 at 2 ug/mL bound an anti-DLL3 recombinant antibody, with an EC50 of 1.625-2.702 ng/mL.
Components / Formulation	PBS, 6% trehalose, pH 7.4
Storage Conditions	Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles.
Shelf Life	Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Package Specifications	20 ug; 100 ug; 1 mg
Product Form	Lyophilized powder
Quality Control	Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity verified by functional ELISA.
Key Features	Active cynomolgus monkey DLL3 extracellular region; 27-490 aa; C-terminal 6xHis tag; mammalian cell expression.
Purity	>=85% by SDS-PAGE.
Activity / Unit Definition	In a functional ELISA, immobilized cynomolgus monkey DLL3 at 2 ug/mL bound an anti-DLL3 recombinant antibody, with an EC50 of 1.625-2.702 ng/mL.
Molecular Weight	50.6 kDa
Source / Origin	Cynomolgus monkey protein produced in mammalian cells.
pH Range / Optimal pH	pH 7.4
Expiration Date / Stability	Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Regulatory / Compliance	For research use only; not for clinical diagnosis or treatment.
Compatibility	Suitable for functional ELISA and DLL3 antibody-binding studies.
Recommended Buffer System	PBS, 6% trehalose, pH 7.4
Application Notes / Precautions	Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week.
Lead Time	3-7 business days
Availability Status	In Stock
Host Species	Cynomolgus monkey (Macaca fascicularis)
Tag Information	C-terminal 6xHis tag
Amino Acid Sequence	AGVFELQIHSFGPGPGPGAPRSPCSARGPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPEAPAPDLPLPNGLLQVPFRDAWPGTFSLIIETWREELGDQIGGPAWSLLARVTRRRRLAAGGPWARDIQRAGAWELRFSYRARCELPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPPVCRAGCSLEHGFCEQPGECRCLEGWTGPLCMVPVSTSSCLGLRGPSSTTTGCLVPGPGPCDGNPCANGGSCSETPGSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRNCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGVSALPAAPPGLRPGDPQR
UniProt Accession	A0A2K5WSR4
Protein Length	464 aa
Expression Region	27-490 aa
Endotoxin Level	<1.0 EU/ug by the LAL method.

Cat.No	Product Name	Price
PTR-HMM-0124	Recombinant Human Interleukin-4 (IL-4), Active	Add To Cart
PTR-HMM-0105	PVDF Blotting Membrane	Add To Cart
PTR-HMM-0031	Difluorocarboxyfluorescein Cadaverine, 5-isomer	Add To Cart
PTR-HMM-0164	Recombinant SARS-CoV-2 Spike Glycoprotein RBD (S), Partial, 6xHis-mFc-Tagged, Active	Add To Cart
PTR-HMM-0196	Recombinant Masked Palm Civet Angiotensin-Converting Enzyme 2 (ACE2), Partial, Active	Add To Cart
PTR-HMM-0152	Recombinant Human C-C Chemokine Receptor Type 2 (CCR2/CD192), Active	Add To Cart
PTR-HMM-0198	Recombinant Human TNF Ligand Superfamily Member 18 (TNFSF18/GITRL), Partial, Active	Add To Cart
PTR-HMM-0176	Recombinant Human Programmed Cell Death Protein 1 (PDCD1/PD-1), Partial, Active	Add To Cart
PTR-HMM-0298	Recombinant Cynomolgus Monkey CD44 Antigen, Partial, Active	Add To Cart
PTR-HMM-0064	Protein A/G Magnetic Beads for Immunoprecipitation	Add To Cart

For research use only, not for clinical use.