- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant SARS-CoV-2 Spike RBD (S), E484K, Residues 319-541, Active |
| Catalog No. | PTR-HMM-0218 |
| Description | A recombinant SARS-CoV-2 spike receptor-binding domain spanning residues 319-541 and carrying the E484K substitution, produced in mammalian cells with a C-terminal mFc tag. ACE2 and antibody binding were verified by functional ELISA. |
| Intended Use | Suitable for functional ELISA and studies of the SARS-CoV-2 E484K RBD interaction with ACE2 or spike-specific antibodies. |
| Principle / Technology | A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays. |
| Detection Method | SDS-PAGE; functional ELISA; LAL assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=90% as determined by SDS-PAGE. Molecular weight: 54.4 kDa. Package sizes: 20 ug; 100 ug; 1 mg. |
| Sensitivity / LOD | Functional ELISA showed binding to human ACE2 with an EC50 of 6.597-8.187 ng/mL and to a biotinylated spike-specific antibody with an EC50 of 21.54-26.77 ng/mL. |
| Specificity | Binding activity was demonstrated with human ACE2 and a spike-specific antibody. |
| Reaction Conditions / Protocol | Functional ELISA showed binding to human ACE2 with an EC50 of 6.597-8.187 ng/mL and to a biotinylated spike-specific antibody with an EC50 of 21.54-26.77 ng/mL. |
| Components / Formulation | PBS, 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity verified by functional ELISA. |
| Key Features | Active E484K spike RBD; 319-541 aa; C-terminal mFc tag; mammalian cell expression. |
| Purity | >=90% as determined by SDS-PAGE. |
| Activity / Unit Definition | Functional ELISA showed binding to human ACE2 with an EC50 of 6.597-8.187 ng/mL and to a biotinylated spike-specific antibody with an EC50 of 21.54-26.77 ng/mL. |
| Molecular Weight | 54.4 kDa |
| Source / Origin | SARS-CoV-2 protein produced in Mammalian cell. |
| pH Range / Optimal pH | pH 7.4 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA and studies of the SARS-CoV-2 E484K RBD interaction with ACE2 or spike-specific antibodies. |
| Recommended Buffer System | PBS, 6% trehalose, pH 7.4 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Genotype | E484K |
| Alternative Names / Synonyms | Spike glycoprotein; S glycoprotein; E2; Peplomer protein |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | SARS-CoV-2 |
| Tag Information | C-terminal mFc tag |
| Amino Acid Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| UniProt Accession | P0DTC2 |
| Protein Length | 223 aa |
| Expression Region | 319-541 aa (E484K) |
| Endotoxin Level | <1.0 EU/ug as determined by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
