- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant SARS-CoV-2 Spike Glycoprotein (S), Residues 16-318, Partial |
| Catalog No. | PTR-HMM-0217 |
| Description | A recombinant SARS-CoV-2 spike glycoprotein fragment spanning residues 16-318, expressed in yeast with an N-terminal 6xHis-PDI tag. Purity was evaluated by SDS-PAGE. |
| Intended Use | Suitable for research involving the SARS-CoV-2 spike region represented by residues 16-318. |
| Principle / Technology | A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays. |
| Detection Method | SDS-PAGE |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=90% as determined by SDS-PAGE. Molecular weight: 93.2 kDa. Package sizes: 20 ug; 100 ug; 1 mg. |
| Components / Formulation | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE. |
| Key Features | SARS-CoV-2 spike fragment; 16-318 aa; N-terminal 6xHis-PDI tag; yeast expression. |
| Purity | >=90% as determined by SDS-PAGE. |
| Molecular Weight | 93.2 kDa |
| Source / Origin | SARS-CoV-2 protein produced in Yeast. |
| pH Range / Optimal pH | pH 8.0 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for research involving the SARS-CoV-2 spike region represented by residues 16-318. |
| Recommended Buffer System | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | Spike glycoprotein; S glycoprotein; E2; Peplomer protein |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | SARS-CoV-2 |
| Tag Information | N-terminal 6xHis-PDI tag |
| Amino Acid Sequence | VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNF |
| UniProt Accession | P0DTC2 |
| Protein Length | 303 aa |
| Expression Region | 16-318 aa |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
