- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant SARS-CoV-2 Spike Glycoprotein (S), Partial, Active |
| Catalog No. | PTR-HMM-0161 |
| Description | An active recombinant SARS-CoV-2 S construct representing the partial spike ectodomain (16-685 aa) and produced in mammalian cells. The protein carries a N-terminal 10×His tag and C-terminal FLAG tag and is supplied for research use. |
| Intended Use | For research use in functional ELISA; viral receptor-binding studies; antibody characterization. |
| Principle / Technology | Recombinant expression in mammalian cells, followed by purification and functional qualification with sDS-PAGE; functional ELISA. |
| Detection Method | SDS-PAGE; functional ELISA |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | ≥90% by SDS-PAGE; molecular weight 79.6 kDa; package options: 20 µg; 100 µg; 1 mg. |
| Sensitivity / LOD | ACE2-binding EC50 56.64-103.6 ng/mL; antibody-binding EC50 36.79-48.87 ng/mL. |
| Specificity | Binds human ACE2 and is recognized by anti-spike antibodies. |
| Reaction Conditions / Protocol | Briefly centrifuge the vial before opening, then reconstitute with sterile deionized water to 0.1-1.0 mg/mL. |
| Components / Formulation | 20 mM Tris-HCl, 0.5 M NaCl and 6% trehalose, pH 8.0 |
| Storage Conditions | Store at -20°C or -80°C. Prepare working aliquots after opening or reconstitution and avoid repeated freeze-thaw cycles. |
| Shelf Life | Lyophilized material: up to 12 months at -20°C to -80°C. |
| Package Specifications | 20 µg; 100 µg; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity assessed by SDS-PAGE; functional performance verified in the stated bioassay; endotoxin level <1.0 EU/µg. |
| Key Features | Functionally tested active protein; defined 16-685 aa construct; N-terminal 10×His tag and C-terminal FLAG tag; ≥90% by SDS-PAGE. |
| Purity | ≥90% by SDS-PAGE |
| Activity / Unit Definition | Functional ELISA confirmed binding to human ACE2 with an EC50 of 56.64-103.6 ng/mL and recognition by an anti-spike antibody with an EC50 of 36.79-48.87 ng/mL. |
| Molecular Weight | 79.6 kDa |
| Source / Origin | SARS-CoV-2 protein produced in mammalian cells. |
| pH Range / Optimal pH | pH 8.0 |
| Expiration Date / Stability | Lyophilized material: up to 12 months at -20°C to -80°C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Functional ELISA; viral receptor-binding studies; antibody characterization |
| Recommended Buffer System | 20 mM Tris-HCl, 0.5 M NaCl and 6% trehalose, pH 8.0 |
| Application Notes / Precautions | After reconstitution, keep a working aliquot at 4°C for no longer than one week. For longer storage, prepare aliquots and avoid repeated freeze-thaw cycles. |
| Alternative Names / Synonyms | Spike glycoprotein; S glycoprotein; E2; peplomer protein |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | SARS-CoV-2 |
| Tag Information | N-terminal 10×His tag and C-terminal FLAG tag |
| Amino Acid Sequence | VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR |
| UniProt Accession | P0DTC2 |
| Protein Length | 670 amino acids |
| Expression Region | 16-685 aa |
| Endotoxin Level | <1.0 EU/µg |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
