Recombinant SARS-CoV-2 Spike Glycoprotein (S), Partial, Active
Research
Online Inquiry

Recombinant SARS-CoV-2 Spike Glycoprotein (S), Partial, Active

Cat.No: PTR-HMM-0161 Datasheet

Quantities:
- +
Product Details Related Products
Product Name Recombinant SARS-CoV-2 Spike Glycoprotein (S), Partial, Active
Catalog No. PTR-HMM-0161
Description An active recombinant SARS-CoV-2 S construct representing the partial spike ectodomain (16-685 aa) and produced in mammalian cells. The protein carries a N-terminal 10×His tag and C-terminal FLAG tag and is supplied for research use.
Intended Use For research use in functional ELISA; viral receptor-binding studies; antibody characterization.
Principle / Technology Recombinant expression in mammalian cells, followed by purification and functional qualification with sDS-PAGE; functional ELISA.
Detection Method SDS-PAGE; functional ELISA
Sample Type Purified recombinant protein
Performance Range / Specifications ≥90% by SDS-PAGE; molecular weight 79.6 kDa; package options: 20 µg; 100 µg; 1 mg.
Sensitivity / LOD ACE2-binding EC50 56.64-103.6 ng/mL; antibody-binding EC50 36.79-48.87 ng/mL.
Specificity Binds human ACE2 and is recognized by anti-spike antibodies.
Reaction Conditions / Protocol Briefly centrifuge the vial before opening, then reconstitute with sterile deionized water to 0.1-1.0 mg/mL.
Components / Formulation 20 mM Tris-HCl, 0.5 M NaCl and 6% trehalose, pH 8.0
Storage Conditions Store at -20°C or -80°C. Prepare working aliquots after opening or reconstitution and avoid repeated freeze-thaw cycles.
Shelf Life Lyophilized material: up to 12 months at -20°C to -80°C.
Package Specifications 20 µg; 100 µg; 1 mg
Product Form Lyophilized powder
Quality Control Purity assessed by SDS-PAGE; functional performance verified in the stated bioassay; endotoxin level <1.0 EU/µg.
Key Features Functionally tested active protein; defined 16-685 aa construct; N-terminal 10×His tag and C-terminal FLAG tag; ≥90% by SDS-PAGE.
Purity ≥90% by SDS-PAGE
Activity / Unit Definition Functional ELISA confirmed binding to human ACE2 with an EC50 of 56.64-103.6 ng/mL and recognition by an anti-spike antibody with an EC50 of 36.79-48.87 ng/mL.
Molecular Weight 79.6 kDa
Source / Origin SARS-CoV-2 protein produced in mammalian cells.
pH Range / Optimal pH pH 8.0
Expiration Date / Stability Lyophilized material: up to 12 months at -20°C to -80°C.
Regulatory / Compliance For research use only; not for clinical diagnosis or treatment.
Compatibility Functional ELISA; viral receptor-binding studies; antibody characterization
Recommended Buffer System 20 mM Tris-HCl, 0.5 M NaCl and 6% trehalose, pH 8.0
Application Notes / Precautions After reconstitution, keep a working aliquot at 4°C for no longer than one week. For longer storage, prepare aliquots and avoid repeated freeze-thaw cycles.
Alternative Names / Synonyms Spike glycoprotein; S glycoprotein; E2; peplomer protein
Lead Time 3-7 business days
Availability Status In Stock
Host Species SARS-CoV-2
Tag Information N-terminal 10×His tag and C-terminal FLAG tag
Amino Acid Sequence VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR
UniProt Accession P0DTC2
Protein Length 670 amino acids
Expression Region 16-685 aa
Endotoxin Level <1.0 EU/µg

For research use only, not for clinical use.

0
0

There is no product in your cart.