Recombinant SARS-CoV-2 Spike Glycoprotein RBD (S), V483A Variant, Partial, Active
Research
Online Inquiry

Recombinant SARS-CoV-2 Spike Glycoprotein RBD (S), V483A Variant, Partial, Active

Cat.No: PTR-HMM-0183 Datasheet

Quantities:
- +
Product Details Related Products
Product Name Recombinant SARS-CoV-2 Spike Glycoprotein RBD (S), V483A Variant, Partial, Active
Catalog No. PTR-HMM-0183
Description A recombinant SARS-CoV-2 receptor-binding domain containing the V483A substitution, produced in mammalian cells. The construct spans residues 319-541 and carries a C-terminal 10xHis tag.
Intended Use Suitable for functional ELISA, antibody-binding studies, ACE2 interaction studies, and SARS-CoV-2 variant research.
Principle / Technology A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays.
Detection Method SDS-PAGE; functional ELISA; LAL assay
Sample Type Purified recombinant protein
Performance Range / Specifications Purity: >=90% as determined by SDS-PAGE. Molecular weight: 27.8 kDa. Package sizes: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg.
Sensitivity / LOD In functional ELISA assays, immobilized V483A Spike RBD at 5 ug/mL bound human ACE2 with an EC50 of 196.4-272.1 ng/mL; at 2 ug/mL it bound a SARS-CoV-2 Spike antibody with an EC50 of 7.481-18.76 ng/mL.
Specificity Binding activity was demonstrated with human ACE2 and a SARS-CoV-2 Spike antibody.
Reaction Conditions / Protocol In functional ELISA assays, immobilized V483A Spike RBD at 5 ug/mL bound human ACE2 with an EC50 of 196.4-272.1 ng/mL; at 2 ug/mL it bound a SARS-CoV-2 Spike antibody with an EC50 of 7.481-18.76 ng/mL.
Components / Formulation 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0
Storage Conditions Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles.
Shelf Life Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Package Specifications 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg
Product Form Lyophilized powder
Quality Control Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity verified by functional ELISA.
Key Features Active recombinant protein; 319-541 aa (V483A); C-terminal 10xHis tag; Mammalian cell.
Purity >=90% as determined by SDS-PAGE.
Activity / Unit Definition In functional ELISA assays, immobilized V483A Spike RBD at 5 ug/mL bound human ACE2 with an EC50 of 196.4-272.1 ng/mL; at 2 ug/mL it bound a SARS-CoV-2 Spike antibody with an EC50 of 7.481-18.76 ng/mL.
Molecular Weight 27.8 kDa
Source / Origin SARS-CoV-2 protein produced in Mammalian cell.
pH Range / Optimal pH pH 8.0
Expiration Date / Stability Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Regulatory / Compliance For research use only; not for clinical diagnosis or treatment.
Compatibility Suitable for functional ELISA, antibody-binding studies, ACE2 interaction studies, and SARS-CoV-2 variant research.
Recommended Buffer System 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0
Application Notes / Precautions Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week.
Genotype V483A
Alternative Names / Synonyms S; Spike glycoprotein; S glycoprotein; E2; Peplomer protein
Lead Time 3-7 business days
Availability Status In Stock
Host Species SARS-CoV-2
Tag Information C-terminal 10xHis tag
Amino Acid Sequence RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGAEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
UniProt Accession P0DTC2
Protein Length 223 aa
Expression Region 319-541 aa (V483A)
Endotoxin Level <1.0 EU/ug as determined by the LAL method.

For research use only, not for clinical use.

0
0

There is no product in your cart.