- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant SARS-CoV-2 Spike Glycoprotein RBD (S), V367F Variant, Partial, Active |
| Catalog No. | PTR-HMM-0180 |
| Description | SARS-CoV-2 spike receptor-binding domain spanning residues 319-541 with the V367F substitution, expressed in mammalian cells and fused to a C-terminal 10xHis tag. ACE2-binding activity is verified by functional ELISA. |
| Intended Use | ACE2-binding ELISA, SARS-CoV-2 variant research, antigen studies, and assay development. |
| Principle / Technology | A defined recombinant protein region is expressed and purified, then its structural integrity and target-binding function are evaluated using the listed biochemical binding assays. |
| Detection Method | SDS-PAGE; functional ELISA |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | >=90% by SDS-PAGE; calculated molecular weight 27.9 kDa; package options: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg. |
| Sensitivity / LOD | In functional ELISA, the V367F spike RBD bound human ACE2 with an EC50 of 65.58-90.16 ng/mL. |
| Specificity | Binds human ACE2. |
| Reaction Conditions / Protocol | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. |
| Components / Formulation | 20 mM Tris-HCl, 0.5 M NaCl, and 6% trehalose, pH 8.0 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity verified by functional ELISA. |
| Key Features | Active SARS-CoV-2 recombinant protein; 319-541 aa expression region; Mammalian cell expression; C-terminal 10xHis tag; >=90% by SDS-PAGE; low endotoxin. |
| Purity | >=90% by SDS-PAGE |
| Activity / Unit Definition | In functional ELISA, the V367F spike RBD bound human ACE2 with an EC50 of 65.58-90.16 ng/mL. |
| Molecular Weight | 27.9 kDa |
| Source / Origin | SARS-CoV-2 protein produced in Mammalian cell. |
| pH Range / Optimal pH | 8.0 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | ACE2-binding ELISA, SARS-CoV-2 variant research, antigen studies, and assay development. |
| Recommended Buffer System | 20 mM Tris-HCl, 0.5 M NaCl, and 6% trehalose, pH 8.0 |
| Application Notes / Precautions | Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Genotype | V367F |
| Alternative Names / Synonyms | S; Spike glycoprotein; S glycoprotein; E2; Peplomer protein |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | SARS-CoV-2 |
| Tag Information | C-terminal 10xHis tag |
| Amino Acid Sequence | RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSFLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| UniProt Accession | P0DTC2 |
| Protein Length | 223 amino acids |
| Expression Region | 319-541 aa |
| Endotoxin Level | <1.0 EU/ug by LAL assay |
For research use only, not for clinical use.
|
There is no product in your cart. |