Recombinant SARS-CoV-2 Spike Glycoprotein RBD (S), N501Y Variant, Partial, 6xHis-mFc-Tagged, Active
Research
Online Inquiry

Recombinant SARS-CoV-2 Spike Glycoprotein RBD (S), N501Y Variant, Partial, 6xHis-mFc-Tagged, Active

Cat.No: PTR-HMM-0192 Datasheet

Quantities:
- +
Product Details Related Products
Product Name Recombinant SARS-CoV-2 Spike Glycoprotein RBD (S), N501Y Variant, Partial, 6xHis-mFc-Tagged, Active
Catalog No. PTR-HMM-0192
Description A recombinant SARS-CoV-2 receptor-binding domain carrying the N501Y substitution, expressed in mammalian cells. This version spans residues 319-541 and includes a C-terminal 6xHis-mFc tag.
Intended Use Suitable for functional ELISA, ACE2-binding studies, Fc-based detection, and SARS-CoV-2 N501Y variant research.
Principle / Technology A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays.
Detection Method SDS-PAGE; functional ELISA; LAL assay
Sample Type Purified recombinant protein
Performance Range / Specifications Purity: >=90% as determined by SDS-PAGE. Molecular weight: 55.3 kDa. Package sizes: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg.
Sensitivity / LOD In a functional ELISA, immobilized N501Y Spike RBD at 2 ug/mL bound biotinylated human ACE2 with an EC50 of 2.492-4.401 ng/mL.
Specificity Binding activity was demonstrated with biotinylated human ACE2.
Reaction Conditions / Protocol In a functional ELISA, immobilized N501Y Spike RBD at 2 ug/mL bound biotinylated human ACE2 with an EC50 of 2.492-4.401 ng/mL.
Components / Formulation PBS, 6% trehalose, pH 7.4
Storage Conditions Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles.
Shelf Life Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Package Specifications 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg
Product Form Lyophilized powder
Quality Control Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity verified by functional ELISA.
Key Features Active recombinant protein; 319-541 aa (N501Y); C-terminal 6xHis-mFc tag; Mammalian cell.
Purity >=90% as determined by SDS-PAGE.
Activity / Unit Definition In a functional ELISA, immobilized N501Y Spike RBD at 2 ug/mL bound biotinylated human ACE2 with an EC50 of 2.492-4.401 ng/mL.
Molecular Weight 55.3 kDa
Source / Origin SARS-CoV-2 protein produced in Mammalian cell.
pH Range / Optimal pH pH 7.4
Expiration Date / Stability Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Regulatory / Compliance For research use only; not for clinical diagnosis or treatment.
Compatibility Suitable for functional ELISA, ACE2-binding studies, Fc-based detection, and SARS-CoV-2 N501Y variant research.
Recommended Buffer System PBS, 6% trehalose, pH 7.4
Application Notes / Precautions Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week.
Genotype N501Y
Alternative Names / Synonyms S; Spike glycoprotein; S glycoprotein; E2; Peplomer protein
Lead Time 3-7 business days
Availability Status In Stock
Host Species SARS-CoV-2
Tag Information C-terminal 6xHis-mFc tag
Amino Acid Sequence RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
UniProt Accession P0DTC2
Protein Length 223 aa
Expression Region 319-541 aa (N501Y)
Endotoxin Level <1.0 EU/ug as determined by the LAL method.

For research use only, not for clinical use.

0
0

There is no product in your cart.