- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Mouse Retinol-Binding Protein 4 (RBP4), Active |
| Catalog No. | PTR-HMM-0281 |
| Description | An active recombinant mature Fc-fusion protein of mouse retinol-binding protein 4, covering residues 19-201, produced in mammalian cells with c-terminal human fc1 tag. The preparation is designed for reproducible protein-binding and assay-development studies. |
| Intended Use | Suitable for Rbp4 antibody-binding studies, functional assays, target research, and assay development. |
| Principle / Technology | The specified mouse Rbp4 region is expressed in mammalian cells, purified, and evaluated through functional binding or activity testing. |
| Detection Method | SDS-PAGE; functional ELISA; LAL assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=90% by SDS-PAGE. EC50: 38.07-75.83 ng/mL. Molecular weight: 50.3 kDa. Package sizes: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg. |
| Sensitivity / LOD | EC50: 38.07-75.83 ng/mL. |
| Specificity | Binding activity was demonstrated with mouse transthyretin. |
| Reaction Conditions / Protocol | In a functional ELISA, immobilized mouse TTR at 5 ug/mL bound recombinant mouse RBP4 with an EC50 of 38. |
| Components / Formulation | PBS, 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity validated by functional testing. |
| Key Features | Active mouse Rbp4; residues 19-201 aa; C-terminal human Fc1 tag; mammalian cells; low endotoxin. |
| Purity | >=90% by SDS-PAGE. |
| Activity / Unit Definition | In a functional ELISA, immobilized mouse TTR at 5 ug/mL bound recombinant mouse RBP4 with an EC50 of 38.07-75.83 ng/mL. |
| Molecular Weight | 50.3 kDa |
| Source / Origin | Mouse protein produced in Mammalian cells. |
| pH Range / Optimal pH | pH 7.4 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional assays and Rbp4-focused protein interaction studies. |
| Recommended Buffer System | PBS, 6% trehalose, pH 7.4 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | Plasma retinol-binding protein; PRBP; RBP |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Mouse |
| Tag Information | C-terminal human Fc1 tag |
| Amino Acid Sequence | ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLSPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL |
| UniProt Accession | Q00724 |
| Protein Length | 183 aa |
| Expression Region | 19-201 aa |
| Endotoxin Level | <1.0 EU/ug by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
