Recombinant Mouse GDNF Family Receptor Alpha-Like (Gfral), Partial, Active
Research
Online Inquiry

Recombinant Mouse GDNF Family Receptor Alpha-Like (Gfral), Partial, Active

Cat.No: PTR-HMM-0222 Datasheet

Quantities:
- +
Product Details Related Products
Product Name Recombinant Mouse GDNF Family Receptor Alpha-Like (Gfral), Partial, Active
Catalog No. PTR-HMM-0222
Description A recombinant mouse Gfral extracellular region spanning residues 20-349, produced in mammalian cells with an N-terminal 10xHis tag and a C-terminal Myc tag. Ligand-binding activity was verified by functional ELISA.
Intended Use Suitable for functional ELISA, Gdf15-Gfral interaction studies, metabolic signaling research, and receptor biology applications.
Principle / Technology A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays.
Detection Method SDS-PAGE; functional ELISA; LAL assay
Sample Type Purified recombinant protein
Performance Range / Specifications Purity: >=95% by SDS-PAGE. Molecular weight: 42.1 kDa. Package sizes: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg.
Sensitivity / LOD Functional ELISA EC50: 7.926-10.52 ng/mL for binding to mouse Gdf15.
Specificity Binding activity was demonstrated with mouse Gdf15.
Reaction Conditions / Protocol In a functional ELISA, immobilized mouse Gfral at 5 ug/mL bound mouse Gdf15, with an EC50 of 7.926-10.52 ng/mL.
Components / Formulation 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0
Storage Conditions Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles.
Shelf Life Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Package Specifications 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg
Product Form Lyophilized powder
Quality Control Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity verified by functional ELISA.
Key Features Active mouse Gfral extracellular region; 20-349 aa; dual terminal tags; mammalian cell expression.
Purity >=95% by SDS-PAGE.
Activity / Unit Definition In a functional ELISA, immobilized mouse Gfral at 5 ug/mL bound mouse Gdf15, with an EC50 of 7.926-10.52 ng/mL.
Molecular Weight 42.1 kDa
Source / Origin Mouse protein produced in mammalian cells.
pH Range / Optimal pH pH 8.0
Expiration Date / Stability Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Regulatory / Compliance For research use only; not for clinical diagnosis or treatment.
Compatibility Suitable for functional ELISA and mouse Gdf15-Gfral binding studies.
Recommended Buffer System 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0
Application Notes / Precautions Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week.
Lead Time 3-7 business days
Availability Status In Stock
Host Species Mouse
Tag Information N-terminal 10xHis tag and C-terminal Myc tag
Amino Acid Sequence QTNDCAHLIQKCLIDANGCEQSWRSMEDTCLTPGDSCKINNSLHCNLSIQALVEKNFQFKECLCMDDLHCTVNKLFGKKCTNKTDNMEKDNKDKWNLTTTPFYHGFKQMQSCLEVTEACVGDVVCNAQLALYLKACSANGNLCDVKHCQAAIRFFYQNMPFNTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNIVPPPTCLSVIHTCRNDELCRTHYRTFQTECWPHITGKCHEDETCISMLGKQDLTCSGSESCRAAFLGTFGTVLQVPCACRGVTQAEEHVCMIFQHMLHSKSCFNYPTPNVKDISSYEKKNSKEITLTGFNSFFNG
UniProt Accession Q6SJE0
Protein Length 330 aa
Expression Region 20-349 aa
Endotoxin Level <1.0 EU/ug by the LAL method.

For research use only, not for clinical use.

0
0

There is no product in your cart.