- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human UL16-Binding Protein 1 (ULBP1), Mature Protein, Active |
| Catalog No. | PTR-HMM-0172 |
| Description | Mature human ULBP1 extracellular protein spanning residues 26-216, expressed in mammalian cells with a C-terminal hFc1-Myc tag. The active protein is validated for high-affinity binding to NKG2D/KLRK1. |
| Intended Use | NKG2D-ligand interaction studies, functional ELISA, LSPR, immune receptor research, and assay development. |
| Principle / Technology | A defined recombinant protein region is expressed and purified, then its structural integrity and target-binding function are evaluated using the listed biochemical binding assays. |
| Detection Method | SDS-PAGE; functional ELISA; LSPR |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | >=90% by SDS-PAGE; calculated molecular weight 52.4 kDa; package options: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg. |
| Sensitivity / LOD | In functional ELISA, ULBP1 bound human NKG2D/KLRK1 with an EC50 of 228.5-427.6 ng/mL. LSPR measured a binding affinity of 2.27 nM. |
| Specificity | Binds human NKG2D/KLRK1. |
| Reaction Conditions / Protocol | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. |
| Components / Formulation | Tris- or PBS-based buffer containing 6% trehalose before lyophilization |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity verified by functional ELISA, LSPR. |
| Key Features | Active Human recombinant protein; 26-216 aa expression region; Mammalian cell expression; C-terminal hFc1-Myc tag; >=90% by SDS-PAGE; low endotoxin. |
| Purity | >=90% by SDS-PAGE |
| Activity / Unit Definition | In functional ELISA, ULBP1 bound human NKG2D/KLRK1 with an EC50 of 228.5-427.6 ng/mL. LSPR measured a binding affinity of 2.27 nM. |
| Molecular Weight | 52.4 kDa |
| Source / Origin | Human protein produced in Mammalian cell. |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | NKG2D-ligand interaction studies, functional ELISA, LSPR, immune receptor research, and assay development. |
| Recommended Buffer System | Tris- or PBS-based buffer containing 6% trehalose before lyophilization |
| Application Notes / Precautions | Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | ALCAN-beta; NKG2D ligand 1; N2DL-1; NKG2DL1; Retinoic acid early transcript 1I |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal hFc1-Myc tag |
| Amino Acid Sequence | GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPG |
| UniProt Accession | Q9BZM6 |
| Protein Length | 191 amino acids |
| Expression Region | 26-216 aa |
| Endotoxin Level | <1.0 EU/ug by LAL assay |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
