- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Transmembrane Protease Serine 2 (TMPRSS2), Partial, Active |
| Catalog No. | PTR-HMM-0125 |
| Description | An active recombinant human TMPRSS2 protein representing partial, produced using Yeast and purified for functional protein research. |
| Intended Use | For protein interaction studies, antibody evaluation, assay development, functional characterization and related life-science research. |
| Principle / Technology | Recombinant expression using Yeast, followed by purification and functional qualification. |
| Detection Method | Fluorogenic enzyme kinetics and inhibitor assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Package options: 20 ug; 100 ug; 1 mg. Purity: >=85% by SDS-PAGE. Functional performance: The enzyme cleaves Boc-Gln-Ala-Arg-AMC with a Km of 21.93 uM. Camostat mesylate inhibits the activity with an EC50 of 0.03347-0.07945 uM. |
| Sensitivity / LOD | Substrate Km: 21.93 uM; camostat mesylate EC50: 0.03347-0.07945 uM |
| Specificity | Human TMPRSS2 |
| Reaction Conditions / Protocol | The enzyme cleaves Boc-Gln-Ala-Arg-AMC with a Km of 21.93 uM. Camostat mesylate inhibits the activity with an EC50 of 0.03347-0.07945 uM. |
| Components / Formulation | Liquid material is supplied in Tris or PBS with 5%-50% glycerol; lyophilized material is supplied in Tris or PBS containing 6% trehalose |
| Storage Conditions | Store at -20 C or -80 C. Prepare working aliquots for repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Liquid: 6 months at -20 C or -80 C. Lyophilized: 12 months at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Liquid or lyophilized powder |
| Quality Control | Purity is assessed by the method stated in the specification. Functional performance is qualified by fluorogenic enzyme kinetics and inhibitor assay. |
| Key Features | Active recombinant human TMPRSS2; Partial; Yeast; >=85% by SDS-PAGE purity; documented functional performance. |
| Purity | >=85% by SDS-PAGE |
| Activity / Unit Definition | The enzyme cleaves Boc-Gln-Ala-Arg-AMC with a Km of 21.93 uM. Camostat mesylate inhibits the activity with an EC50 of 0.03347-0.07945 uM. |
| Molecular Weight | 44.8 kDa |
| Source / Origin | Human; recombinant production using Yeast. |
| Expiration Date / Stability | Liquid material is stable for 6 months at -20 C or -80 C; lyophilized material is stable for 12 months at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Fluorogenic protease assay; enzyme kinetics; inhibitor screening; TMPRSS2 research |
| Recommended Buffer System | Liquid material is supplied in Tris or PBS with 5%-50% glycerol; lyophilized material is supplied in Tris or PBS containing 6% trehalose |
| Application Notes / Precautions | Briefly centrifuge lyophilized material before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For extended storage after reconstitution, add glycerol to a final concentration of 5%-50%, prepare working aliquots and avoid repeated freeze-thaw cycles. Working aliquots may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | TMPRSS2; PRSS10; Transmembrane protease serine 2; Serine protease 10 |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | N-terminal 6xHis-tagged |
| Amino Acid Sequence | WKFMGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLRCIACGVNLNSSRQSRIVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGILRQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQPEQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADG |
| UniProt Accession | O15393 |
| Protein Length | 387 aa |
| Expression Region | 106-492 aa |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
