Recombinant Human TNFRSF17 (BCMA), Partial (Active)
Research
Online Inquiry

Recombinant Human TNFRSF17 (BCMA), Partial (Active)

Cat.No: PTR-HMM-0108 Datasheet

Quantities:
- +
Product Details Related Products
Product Name Recombinant Human TNFRSF17 (BCMA), Partial (Active)
Catalog No. PTR-HMM-0108
Description An active recombinant human TNFRSF17 protein representing partial, produced in Mammalian cells and purified for protein interaction, antibody-binding and cell-research workflows.
Intended Use For protein interaction studies, antibody evaluation, assay development and related life-science research.
Principle / Technology Recombinant expression in Mammalian cells followed by protein purification and functional qualification.
Detection Method ELISA binding assay
Sample Type Purified recombinant protein
Performance Range / Specifications Package options: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg. Purity: >=90% by SDS-PAGE. Functional performance: Immobilized human BCMA at 2 ug/mL binds an anti-BCMA recombinant antibody with an EC50 of 1.912-2.488 ng/mL. Immobilized human TNFSF13B at 10 ug/mL binds human BCMA with an EC50 of 221.3-298.6 ng/mL. TNFSF13B-Fc immobilized on a COOH chip binds BCMA-Fc with an affinity of 39 nM by LSPR. Immobilized BCMA at 5 ug/mL binds biotinylated TNFSF13B with an EC50 of 0.1752-0.3657 ng/mL.
Sensitivity / LOD EC50: 1.912-2.488 ng/mL, 221.3-298.6 ng/mL and 0.1752-0.3657 ng/mL; LSPR affinity: 39 nM
Specificity Human TNFRSF17
Reaction Conditions / Protocol Immobilized human BCMA at 2 ug/mL binds an anti-BCMA recombinant antibody with an EC50 of 1.912-2.488 ng/mL. Immobilized human TNFSF13B at 10 ug/mL binds human BCMA with an EC50 of 221.3-298.6 ng/mL. TNFSF13B-Fc immobilized on a COOH chip binds BCMA-Fc with an affinity of 39 nM by LSPR. Immobilized BCMA at 5 ug/mL binds biotinylated TNFSF13B with an EC50 of 0.1752-0.3657 ng/mL.
Components / Formulation PBS containing 6% trehalose, pH 7.4
Storage Conditions Store at -20 C or -80 C. Prepare working aliquots when multiple uses are expected and avoid repeated freeze-thaw cycles.
Shelf Life Liquid: 6 months at -20 C or -80 C. Lyophilized: 12 months at -20 C or -80 C.
Package Specifications 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg
Product Form Liquid or lyophilized powder
Quality Control Purity assessed by SDS-PAGE. Functional activity qualified by elisa binding assay.
Key Features Active recombinant human TNFRSF17; Partial; Mammalian cells expression; >=90% by SDS-PAGE purity; defined functional activity; endotoxin <1.0 EU/ug by LAL assay.
Purity >=90% by SDS-PAGE
Activity / Unit Definition Immobilized human BCMA at 2 ug/mL binds an anti-BCMA recombinant antibody with an EC50 of 1.912-2.488 ng/mL. Immobilized human TNFSF13B at 10 ug/mL binds human BCMA with an EC50 of 221.3-298.6 ng/mL. TNFSF13B-Fc immobilized on a COOH chip binds BCMA-Fc with an affinity of 39 nM by LSPR. Immobilized BCMA at 5 ug/mL binds biotinylated TNFSF13B with an EC50 of 0.1752-0.3657 ng/mL.
Molecular Weight 34.8 kDa
Source / Origin Human; recombinant expression in Mammalian cells.
pH Range / Optimal pH 7.4
Shipping Conditions Shipped with blue ice packs; dry-ice shipment may be arranged when required.
Expiration Date / Stability Liquid material is stable for 6 months at -20 C or -80 C; lyophilized material is stable for 12 months at -20 C or -80 C.
Regulatory / Compliance For research use only; not for clinical diagnosis or treatment.
Compatibility Protein interaction assays; antibody-binding assays; assay development; biochemical research
Recommended Buffer System PBS containing 6% trehalose, pH 7.4
Application Notes / Precautions Avoid repeated freeze-thaw cycles. For multiple uses, divide the material into working aliquots. Liquid material may be held at 4 C for up to one week during active use.
Alternative Names / Synonyms TNFRSF17; BCM; BCMA; CD269; B cell maturation antigen; B cell maturation factor; B cell maturation protein; Tumor necrosis factor receptor superfamily member 17
Lead Time 1-3 working days
Availability Status In Stock
Host Species Human
Tag Information C-terminal human Fc1-tagged
Amino Acid Sequence MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
UniProt Accession Q02223
Protein Length 54 aa
Expression Region 1-54 aa
Endotoxin Level <1.0 EU/ug by LAL assay

For research use only, not for clinical use.

0
0

There is no product in your cart.