- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human TNF Receptor Superfamily Member 5 (CD40), Partial, Active |
| Catalog No. | PTR-HMM-0199 |
| Description | A recombinant human CD40 extracellular region spanning residues 21-193, expressed in mammalian cells with a C-terminal human Fc tag. CD40L binding was verified by functional ELISA and LSPR. |
| Intended Use | Suitable for functional ELISA, LSPR, and CD40-CD40L interaction studies. |
| Principle / Technology | A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays. |
| Detection Method | SDS-PAGE; SEC-HPLC; functional ELISA; LSPR; LAL assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=95% as determined by SDS-PAGE and >=95% as determined by SEC-HPLC. Molecular weight: 48.0 kDa. Package sizes: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg. |
| Sensitivity / LOD | Functional ELISA showed binding to CD40L with an EC50 of 3.112-3.858 ng/mL. LSPR measured a CD40-CD40L affinity constant of 2.06 nM. |
| Specificity | Binding activity was demonstrated with human CD40 ligand. |
| Reaction Conditions / Protocol | Functional ELISA showed binding to CD40L with an EC50 of 3.112-3.858 ng/mL. LSPR measured a CD40-CD40L affinity constant of 2.06 nM. |
| Components / Formulation | PBS, 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE and SEC-HPLC; endotoxin tested by LAL assay; biological activity verified by functional ELISA and LSPR. |
| Key Features | Active recombinant protein; 21-193 aa; C-terminal hFc1 tag; Mammalian cell. |
| Purity | >=95% as determined by SDS-PAGE and >=95% as determined by SEC-HPLC. |
| Activity / Unit Definition | Functional ELISA showed binding to CD40L with an EC50 of 3.112-3.858 ng/mL. LSPR measured a CD40-CD40L affinity constant of 2.06 nM. |
| Molecular Weight | 48.0 kDa |
| Source / Origin | Human protein produced in Mammalian cell. |
| pH Range / Optimal pH | pH 7.4 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA, LSPR, and CD40-CD40L interaction studies. |
| Recommended Buffer System | PBS, 6% trehalose, pH 7.4 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | TNFRSF5; B-cell surface antigen CD40; Bp50; CD40L receptor; CDw40; CD antigen CD40 |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal hFc1 tag |
| Amino Acid Sequence | EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLR |
| UniProt Accession | P25942 |
| Protein Length | 173 aa |
| Expression Region | 21-193 aa |
| Endotoxin Level | <1.0 EU/ug as determined by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
