Recombinant Human TNF Ligand Superfamily Member 14 (TNFSF14/LIGHT), Partial, Active
Research
Online Inquiry

Recombinant Human TNF Ligand Superfamily Member 14 (TNFSF14/LIGHT), Partial, Active

Cat.No: PTR-HMM-0190 Datasheet

Quantities:
- +
Product Details Related Products
Product Name Recombinant Human TNF Ligand Superfamily Member 14 (TNFSF14/LIGHT), Partial, Active
Catalog No. PTR-HMM-0190
Description A recombinant human TNFSF14 region spanning residues 74-240, expressed in mammalian cells with an N-terminal hFc-Myc tag. Receptor-binding activity was verified by functional ELISA.
Intended Use Suitable for functional ELISA and TNFRSF14-TNFSF14 interaction studies.
Principle / Technology A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays.
Detection Method SDS-PAGE; functional ELISA; LAL assay
Sample Type Purified recombinant protein
Performance Range / Specifications Purity: >=85% as determined by SDS-PAGE. Molecular weight: 46.7 kDa. Package sizes: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg.
Sensitivity / LOD In a functional ELISA, immobilized TNFRSF14 at 5 ug/mL bound TNFSF14 with an EC50 of 45.44-53.29 ng/mL.
Specificity Binding activity was demonstrated with TNFRSF14.
Reaction Conditions / Protocol In a functional ELISA, immobilized TNFRSF14 at 5 ug/mL bound TNFSF14 with an EC50 of 45.44-53.29 ng/mL.
Components / Formulation PBS, 6% trehalose, pH 7.4
Storage Conditions Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles.
Shelf Life Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Package Specifications 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg
Product Form Lyophilized powder
Quality Control Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity verified by functional ELISA.
Key Features Active recombinant protein; 74-240 aa; N-terminal hFc-Myc tag; Mammalian cell.
Purity >=85% as determined by SDS-PAGE.
Activity / Unit Definition In a functional ELISA, immobilized TNFRSF14 at 5 ug/mL bound TNFSF14 with an EC50 of 45.44-53.29 ng/mL.
Molecular Weight 46.7 kDa
Source / Origin Human protein produced in Mammalian cell.
pH Range / Optimal pH pH 7.4
Expiration Date / Stability Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Regulatory / Compliance For research use only; not for clinical diagnosis or treatment.
Compatibility Suitable for functional ELISA and TNFRSF14-TNFSF14 interaction studies.
Recommended Buffer System PBS, 6% trehalose, pH 7.4
Application Notes / Precautions Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week.
Alternative Names / Synonyms HVEML; LIGHT; Herpesvirus entry mediator ligand; HVEM-L; CD258
Lead Time 3-7 business days
Availability Status In Stock
Host Species Human
Tag Information N-terminal hFc-Myc tag
Amino Acid Sequence DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
UniProt Accession O43557
Protein Length 167 aa
Expression Region 74-240 aa
Endotoxin Level <1.0 EU/ug as determined by the LAL method.

For research use only, not for clinical use.

0
0

There is no product in your cart.