- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Somatostatin Receptor Type 2 (SSTR2) VLPs, Active |
| Catalog No. | PTR-HMM-0287 |
| Description | A full-length human somatostatin receptor type 2 membrane protein presented in a mammalian-cell-derived virus-like particle format. The preparation preserves a membrane-associated antigenic presentation and is supplied with c-terminal 6xhis tag; detectable under denaturing conditions. |
| Intended Use | Suitable for SSTR2 antibody screening, membrane-protein binding studies, functional ELISA, and VLP-based assay development. |
| Principle / Technology | Full-length membrane protein is expressed in mammalian cells and displayed in a virus-like particle format to preserve a membrane-associated conformation for antibody and ligand-binding analysis. |
| Detection Method | Functional ELISA; anti-His immunodetection under denaturing conditions; LAL assay; flow cytometry; transmission electron microscopy |
| Sample Type | Purified recombinant VLP preparation |
| Performance Range / Specifications | EC50: 58.13-81.28 ng/mL. Molecular weight: 42.5 kDa. Package sizes: 20 ug; 100 ug; 1 mg. |
| Sensitivity / LOD | EC50: 58.13-81.28 ng/mL. |
| Specificity | Binding and blocking activity were demonstrated with SSTR2-specific reagents and SSTR2-expressing cells. |
| Reaction Conditions / Protocol | Evaluate concentration-dependent antibody binding using immobilized VLP material in a functional ELISA. |
| Components / Formulation | PBS, 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | endotoxin tested by LAL assay; biological activity validated by functional testing. |
| Key Features | Full-length human SSTR2 VLPs; 369 aa; C-terminal 6xHis tag; detectable under denaturing conditions; mammalian expression; low endotoxin. Cell-blocking activity and VLP morphology verified. |
| Activity / Unit Definition | In a functional ELISA, immobilized human SSTR2 VLPs at 10 ug/mL bound an SSTR2-specific recombinant antibody with an EC50 of 58.13-81.28 ng/mL. Blocking activity was also demonstrated by flow cytometry using human SSTR2-expressing cells, and VLP morphology was confirmed by transmission electron microscopy. |
| Molecular Weight | 42.5 kDa |
| Source / Origin | Human protein produced in Mammalian cells. |
| pH Range / Optimal pH | pH 7.4 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA, membrane receptor antibody-binding studies, and VLP-based assay development. |
| Recommended Buffer System | PBS, 6% trehalose, pH 7.4 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | SS-2-R; SS2-R; SS2R; SRIF-1 |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal 6xHis tag; detectable under denaturing conditions |
| Amino Acid Sequence | MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI |
| UniProt Accession | P30874 |
| Protein Length | 369 aa |
| Expression Region | 1-369 aa |
| Endotoxin Level | <1.0 EU/ug by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
