Recombinant Human Somatostatin Receptor Type 2 (SSTR2) VLPs, Active
Research
Online Inquiry

Recombinant Human Somatostatin Receptor Type 2 (SSTR2) VLPs, Active

Cat.No: PTR-HMM-0287 Datasheet

Quantities:
- +
Product Details Related Products
Product Name Recombinant Human Somatostatin Receptor Type 2 (SSTR2) VLPs, Active
Catalog No. PTR-HMM-0287
Description A full-length human somatostatin receptor type 2 membrane protein presented in a mammalian-cell-derived virus-like particle format. The preparation preserves a membrane-associated antigenic presentation and is supplied with c-terminal 6xhis tag; detectable under denaturing conditions.
Intended Use Suitable for SSTR2 antibody screening, membrane-protein binding studies, functional ELISA, and VLP-based assay development.
Principle / Technology Full-length membrane protein is expressed in mammalian cells and displayed in a virus-like particle format to preserve a membrane-associated conformation for antibody and ligand-binding analysis.
Detection Method Functional ELISA; anti-His immunodetection under denaturing conditions; LAL assay; flow cytometry; transmission electron microscopy
Sample Type Purified recombinant VLP preparation
Performance Range / Specifications EC50: 58.13-81.28 ng/mL. Molecular weight: 42.5 kDa. Package sizes: 20 ug; 100 ug; 1 mg.
Sensitivity / LOD EC50: 58.13-81.28 ng/mL.
Specificity Binding and blocking activity were demonstrated with SSTR2-specific reagents and SSTR2-expressing cells.
Reaction Conditions / Protocol Evaluate concentration-dependent antibody binding using immobilized VLP material in a functional ELISA.
Components / Formulation PBS, 6% trehalose, pH 7.4
Storage Conditions Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles.
Shelf Life Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Package Specifications 20 ug; 100 ug; 1 mg
Product Form Lyophilized powder
Quality Control endotoxin tested by LAL assay; biological activity validated by functional testing.
Key Features Full-length human SSTR2 VLPs; 369 aa; C-terminal 6xHis tag; detectable under denaturing conditions; mammalian expression; low endotoxin. Cell-blocking activity and VLP morphology verified.
Activity / Unit Definition In a functional ELISA, immobilized human SSTR2 VLPs at 10 ug/mL bound an SSTR2-specific recombinant antibody with an EC50 of 58.13-81.28 ng/mL. Blocking activity was also demonstrated by flow cytometry using human SSTR2-expressing cells, and VLP morphology was confirmed by transmission electron microscopy.
Molecular Weight 42.5 kDa
Source / Origin Human protein produced in Mammalian cells.
pH Range / Optimal pH pH 7.4
Expiration Date / Stability Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Regulatory / Compliance For research use only; not for clinical diagnosis or treatment.
Compatibility Suitable for functional ELISA, membrane receptor antibody-binding studies, and VLP-based assay development.
Recommended Buffer System PBS, 6% trehalose, pH 7.4
Application Notes / Precautions Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week.
Alternative Names / Synonyms SS-2-R; SS2-R; SS2R; SRIF-1
Lead Time 3-7 business days
Availability Status In Stock
Host Species Human
Tag Information C-terminal 6xHis tag; detectable under denaturing conditions
Amino Acid Sequence MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI
UniProt Accession P30874
Protein Length 369 aa
Expression Region 1-369 aa
Endotoxin Level <1.0 EU/ug by the LAL method.

For research use only, not for clinical use.

0
0

There is no product in your cart.