- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Somatostatin Receptor Type 2 (SSTR2), Full Length, Active |
| Catalog No. | PTR-HMM-0131 |
| Description | An active recombinant human SSTR2 protein representing full length, produced using In vitro E. coli expression system and purified for functional protein research. |
| Intended Use | For protein interaction studies, antibody evaluation, assay development, functional characterization and related life-science research. |
| Principle / Technology | Recombinant expression using In vitro E. coli expression system, followed by purification and functional qualification. |
| Detection Method | MetaSPR ligand-binding assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Package options: 20 ug; 100 ug. Purity: >=85% by SDS-PAGE. Functional performance: Full-length SSTR2 captured on a carboxyl sensor chip binds [Tyr3]octreotate with an affinity of 22.9 uM by MetaSPR. |
| Sensitivity / LOD | MetaSPR affinity: 22.9 uM |
| Specificity | Human SSTR2 |
| Reaction Conditions / Protocol | Full-length SSTR2 captured on a carboxyl sensor chip binds [Tyr3]octreotate with an affinity of 22.9 uM by MetaSPR. |
| Components / Formulation | Liquid material is supplied in Tris or PBS with 5%-50% glycerol; lyophilized material is supplied in Tris or PBS containing 6% trehalose |
| Storage Conditions | Store at -20 C or -80 C. Prepare working aliquots for repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Liquid: 6 months at -20 C or -80 C. Lyophilized: 12 months at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug |
| Product Form | Liquid or lyophilized powder |
| Quality Control | Purity is assessed by the method stated in the specification. Functional performance is qualified by metaspr ligand-binding assay. |
| Key Features | Active recombinant human SSTR2; Full length; In vitro E. coli expression system; >=85% by SDS-PAGE purity; documented functional performance. |
| Purity | >=85% by SDS-PAGE |
| Activity / Unit Definition | Full-length SSTR2 captured on a carboxyl sensor chip binds [Tyr3]octreotate with an affinity of 22.9 uM by MetaSPR. |
| Molecular Weight | 47.4 kDa |
| Source / Origin | Human; recombinant production using In vitro E. coli expression system. |
| Expiration Date / Stability | Liquid material is stable for 6 months at -20 C or -80 C; lyophilized material is stable for 12 months at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | MetaSPR; peptide-receptor binding studies; membrane-protein research |
| Recommended Buffer System | Liquid material is supplied in Tris or PBS with 5%-50% glycerol; lyophilized material is supplied in Tris or PBS containing 6% trehalose |
| Application Notes / Precautions | Briefly centrifuge lyophilized material before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For extended storage after reconstitution, add glycerol to a final concentration of 5%-50%, prepare working aliquots and avoid repeated freeze-thaw cycles. Working aliquots may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | Somatostatin receptor type 2; SSTR2; Somatostatin receptor 2 |
| Lead Time | 3-7 working days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | N-terminal 10xHis-tagged |
| Amino Acid Sequence | MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI |
| UniProt Accession | P30874 |
| Protein Length | 369 aa |
| Expression Region | 1-369 aa |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
