- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human SIN3-HDAC Complex-Associated Factor (SINHCAF) (Active) |
| Catalog No. | PTR-HMM-0106 |
| Description | An active recombinant human SINHCAF protein representing full length, produced in E. coli and purified for protein interaction, antibody-binding and cell-research workflows. |
| Intended Use | For protein interaction studies, antibody evaluation, assay development and related life-science research. |
| Principle / Technology | Recombinant expression in E. coli followed by protein purification and functional qualification. |
| Detection Method | ELISA binding assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Package options: 20 ug; 100 ug; 1 mg. Purity: >=85% by SDS-PAGE. Functional performance: Immobilized human LCN2 at 2 ug/mL binds recombinant human SINHCAF with an EC50 of 31.54-38.59 ug/mL. |
| Sensitivity / LOD | EC50: 31.54-38.59 ug/mL |
| Specificity | Human SINHCAF |
| Reaction Conditions / Protocol | Immobilized human LCN2 at 2 ug/mL binds recombinant human SINHCAF with an EC50 of 31.54-38.59 ug/mL. |
| Components / Formulation | Tris-based buffer containing 50% glycerol |
| Storage Conditions | Store at -20 C or -80 C. Prepare working aliquots when multiple uses are expected and avoid repeated freeze-thaw cycles. |
| Shelf Life | Liquid: 6 months at -20 C or -80 C. Lyophilized: 12 months at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Liquid or lyophilized powder |
| Quality Control | Purity assessed by SDS-PAGE. Functional activity qualified by elisa binding assay. |
| Key Features | Active recombinant human SINHCAF; Full length; E. coli expression; >=85% by SDS-PAGE purity; defined functional activity. |
| Purity | >=85% by SDS-PAGE |
| Activity / Unit Definition | Immobilized human LCN2 at 2 ug/mL binds recombinant human SINHCAF with an EC50 of 31.54-38.59 ug/mL. |
| Molecular Weight | 51.9 kDa |
| Source / Origin | Human; recombinant expression in E. coli. |
| Shipping Conditions | Shipped with blue ice packs; dry-ice shipment may be arranged when required. |
| Expiration Date / Stability | Liquid material is stable for 6 months at -20 C or -80 C; lyophilized material is stable for 12 months at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Protein interaction assays; antibody-binding assays; assay development; biochemical research |
| Recommended Buffer System | Tris-based buffer containing 50% glycerol |
| Application Notes / Precautions | Avoid repeated freeze-thaw cycles. For multiple uses, divide the material into working aliquots. Liquid material may be held at 4 C for up to one week during active use. |
| Alternative Names / Synonyms | SINHCAF; C12orf14; FAM60A; L4; SIN3-HDAC complex-associated factor; Protein FAM60A; Tera protein homolog |
| Lead Time | 1-3 working days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | N-terminal GST-tagged |
| Amino Acid Sequence | MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW |
| UniProt Accession | Q9NP50 |
| Protein Length | 221 aa |
| Expression Region | 1-221 aa |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
