- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human R-Spondin-1 (RSPO1), Partial, Active |
| Catalog No. | PTR-HMM-0274 |
| Description | An active recombinant human R-spondin-1 fragment spanning residues 31-263, expressed in mammalian cells with a C-terminal 10xHis-Avi tag. The purified protein binds human LGR5 in a functional ELISA. |
| Intended Use | Suitable for RSPO1-LGR5 interaction studies, Wnt signaling research, functional ELISA, organoid research, and ligand-binding assays. |
| Principle / Technology | The human RSPO1 region is expressed in mammalian cells, purified, and functionally verified through LGR5-binding ELISA. |
| Detection Method | SDS-PAGE; functional ELISA; LAL assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=95% by SDS-PAGE. EC50: 124.0-174.1 ng/mL. Molecular weight: 30.2 kDa. Package sizes: 20 ug; 100 ug; 1 mg. |
| Sensitivity / LOD | EC50: 124.0-174.1 ng/mL. |
| Specificity | Binding activity was demonstrated with human LGR5. |
| Reaction Conditions / Protocol | Immobilize human RSPO1 at 2 ug/mL and assess concentration-dependent binding to human LGR5 by functional ELISA. |
| Components / Formulation | PBS, 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity validated by functional testing. |
| Key Features | Active human RSPO1 fragment; residues 31-263; C-terminal 10xHis-Avi tag; >=95% purity; mammalian expression; low endotoxin. |
| Purity | >=95% by SDS-PAGE. |
| Activity / Unit Definition | In a functional ELISA, immobilized human RSPO1 at 2 ug/mL bound human LGR5 with an EC50 of 124.0-174.1 ng/mL. |
| Molecular Weight | 30.2 kDa |
| Source / Origin | Human protein produced in Mammalian cells. |
| pH Range / Optimal pH | pH 7.4 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA, RSPO1-LGR5 binding studies, Wnt pathway research, and organoid workflows. |
| Recommended Buffer System | PBS, 6% trehalose, pH 7.4 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | Roof plate-specific spondin-1; hRspo1 |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal 10xHis-Avi tag |
| Amino Acid Sequence | RISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA |
| UniProt Accession | Q2MKA7 |
| Protein Length | 233 aa |
| Expression Region | 31-263 aa |
| Endotoxin Level | <1.0 EU/ug by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
