- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Plexin-B1 (PLXNB1), Partial, Active |
| Catalog No. | PTR-HMM-0246 |
| Description | A recombinant human PLXNB1 protein covering residues 20-535, produced in Mammalian cells with N-terminal mouse Fc tag. Biological activity was verified using the listed assay. |
| Intended Use | Suitable for functional ELISA, SEMA4D-PLXNB1 interaction studies, receptor signaling research, and assay development. |
| Principle / Technology | A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays. |
| Detection Method | SDS-PAGE; functional ELISA |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=95% by SDS-PAGE.. Molecular weight: 83.2 kDa. Package sizes: 20 ug; 100 ug; 1 mg. |
| Sensitivity / LOD | In a functional ELISA, immobilized human SEMA4D at 5 ug/mL bound human PLXNB1 with an EC50 of 0.8179-1.357 ug/mL. |
| Specificity | Binding activity was demonstrated with human SEMA4D. |
| Reaction Conditions / Protocol | In a functional ELISA, immobilized human SEMA4D at 5 ug/mL bound human PLXNB1 with an EC50 of 0.8179-1.357 ug/mL. |
| Components / Formulation | PBS, 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by sds-page; endotoxin tested by lal assay; biological activity verified by functional elisa. |
| Key Features | Active recombinant human protein; 20-535 aa; N-terminal mouse Fc tag; Mammalian cells expression. |
| Purity | >=95% by SDS-PAGE. |
| Activity / Unit Definition | In a functional ELISA, immobilized human SEMA4D at 5 ug/mL bound human PLXNB1 with an EC50 of 0.8179-1.357 ug/mL. |
| Molecular Weight | 83.2 kDa |
| Source / Origin | Human protein produced in Mammalian cells. |
| pH Range / Optimal pH | pH 7.4 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA, SEMA4D-PLXNB1 interaction studies, receptor signaling research, and assay development. |
| Recommended Buffer System | PBS, 6% trehalose, pH 7.4 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | Plexin-B1; Semaphorin receptor SEP |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | N-terminal mouse Fc tag |
| Amino Acid Sequence | LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ |
| UniProt Accession | O43157 |
| Protein Length | 516 aa |
| Expression Region | 20-535 aa |
| Endotoxin Level | <1.0 EU/ug by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
