- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Papillomavirus Type 16 Protein E7, Full Length, Active |
| Catalog No. | PTR-HMM-0244 |
| Description | A recombinant human papillomavirus type 16 HPV16 E7 protein covering residues 1-98, produced in E. coli with N-terminal 6xHis tag and C-terminal 6xHis tag. Biological activity was verified using the listed assay. |
| Intended Use | Suitable for functional ELISA, HPV16 E7 interaction studies, viral oncology research, and assay development. |
| Principle / Technology | A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays. |
| Detection Method | SDS-PAGE; functional ELISA |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=90% by SDS-PAGE.. Molecular weight: 16.3 kDa. Package sizes: 20 ug; 100 ug; 1 mg. |
| Sensitivity / LOD | In a functional ELISA, immobilized HPV16 E7 at 10 ug/mL bound biotinylated MYC protein with an EC50 of 268.1-354.3 ng/mL. |
| Specificity | Binding activity was demonstrated with biotinylated MYC protein. |
| Reaction Conditions / Protocol | In a functional ELISA, immobilized HPV16 E7 at 10 ug/mL bound biotinylated MYC protein with an EC50 of 268.1-354.3 ng/mL. |
| Components / Formulation | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by sds-page; biological activity verified by functional elisa. |
| Key Features | Active recombinant human papillomavirus type 16 protein; 1-98 aa; N-terminal 6xHis tag and C-terminal 6xHis tag; E. coli expression. |
| Purity | >=90% by SDS-PAGE. |
| Activity / Unit Definition | In a functional ELISA, immobilized HPV16 E7 at 10 ug/mL bound biotinylated MYC protein with an EC50 of 268.1-354.3 ng/mL. |
| Molecular Weight | 16.3 kDa |
| Source / Origin | Human papillomavirus type 16 protein produced in E. coli. |
| pH Range / Optimal pH | pH 8.0 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA, HPV16 E7 interaction studies, viral oncology research, and assay development. |
| Recommended Buffer System | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | Protein E7 |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human papillomavirus type 16 |
| Tag Information | N-terminal 6xHis tag and C-terminal 6xHis tag |
| Amino Acid Sequence | MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP |
| UniProt Accession | P03129 |
| Protein Length | 98 aa |
| Expression Region | 1-98 aa |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
