- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Macrophage Colony-Stimulating Factor 1 (CSF1/M-CSF), Partial, Active |
| Catalog No. | PTR-HMM-0156 |
| Description | An active recombinant human CSF1 construct representing the partial mature region (33-190 aa) and produced in yeast. The protein carries a C-terminal 6×His tag and is supplied for research use. |
| Intended Use | For research use in tHP-1 cell proliferation assays; cytokine-response studies. |
| Principle / Technology | Recombinant expression in yeast, followed by purification and functional qualification with sDS-PAGE; SEC-HPLC; THP-1 cell proliferation assay. |
| Detection Method | SDS-PAGE; SEC-HPLC; THP-1 cell proliferation assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | >95% by SDS-PAGE and >90% by SEC-HPLC; molecular weight 19.9 kDa; package options: 20 µg; 100 µg; 1 mg. |
| Sensitivity / LOD | ED50 0.5913-1.205 ng/mL in a THP-1 proliferation assay. |
| Specificity | Promotes proliferation of CSF1-responsive THP-1 cells. |
| Reaction Conditions / Protocol | Briefly centrifuge the vial before opening, then reconstitute with sterile deionized water to 0.1-1.0 mg/mL. |
| Components / Formulation | PBS containing 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20°C or -80°C. Prepare working aliquots after opening or reconstitution and avoid repeated freeze-thaw cycles. |
| Shelf Life | Lyophilized material: up to 12 months at -20°C to -80°C. |
| Package Specifications | 20 µg; 100 µg; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity assessed by SDS-PAGE; monomeric purity assessed by SEC-HPLC; functional performance verified in the stated bioassay; endotoxin level <1.0 EU/µg. |
| Key Features | Functionally tested active protein; defined 33-190 aa construct; C-terminal 6×His tag; >95% by SDS-PAGE and >90% by SEC-HPLC. |
| Purity | >95% by SDS-PAGE and >90% by SEC-HPLC |
| Activity / Unit Definition | Biological activity was confirmed in a THP-1 cell proliferation assay with an ED50 of 0.5913-1.205 ng/mL. |
| Molecular Weight | 19.9 kDa |
| Source / Origin | Human protein produced in yeast. |
| pH Range / Optimal pH | pH 7.4 |
| Expiration Date / Stability | Lyophilized material: up to 12 months at -20°C to -80°C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | THP-1 cell proliferation assays; cytokine-response studies |
| Recommended Buffer System | PBS containing 6% trehalose, pH 7.4 |
| Application Notes / Precautions | After reconstitution, keep a working aliquot at 4°C for no longer than one week. For longer storage, prepare aliquots and avoid repeated freeze-thaw cycles. |
| Alternative Names / Synonyms | CSF-1; M-CSF; MCSF |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal 6×His tag |
| Amino Acid Sequence | EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN |
| UniProt Accession | P09603 |
| Protein Length | 158 amino acids |
| Expression Region | 33-190 aa |
| Endotoxin Level | <1.0 EU/µg |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
