- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Lymphotoxin Alpha (LTA/TNF-beta), Mature Protein, Active |
| Catalog No. | PTR-HMM-0200 |
| Description | A recombinant human mature lymphotoxin alpha protein spanning residues 35-205, produced in mammalian cells with an N-terminal 6xHis tag. Binding to TNFRSF1B and TNFR1 was verified by functional ELISA. |
| Intended Use | Suitable for functional ELISA and LTA receptor-binding studies. |
| Principle / Technology | A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays. |
| Detection Method | SDS-PAGE; functional ELISA; LAL assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=95% as determined by SDS-PAGE. Molecular weight: 20.8 kDa. Package sizes: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg. |
| Sensitivity / LOD | Functional ELISA showed binding to human TNFRSF1B with an EC50 of 1.632-2.699 ng/mL and to human TNFR1 with an EC50 of 4.409-6.797 ng/mL. |
| Specificity | Binding activity was demonstrated with human TNFRSF1B and TNFR1. |
| Reaction Conditions / Protocol | Functional ELISA showed binding to human TNFRSF1B with an EC50 of 1.632-2.699 ng/mL and to human TNFR1 with an EC50 of 4.409-6.797 ng/mL. |
| Components / Formulation | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity verified by functional ELISA. |
| Key Features | Active recombinant protein; 35-205 aa; N-terminal 6xHis tag; Mammalian cell. |
| Purity | >=95% as determined by SDS-PAGE. |
| Activity / Unit Definition | Functional ELISA showed binding to human TNFRSF1B with an EC50 of 1.632-2.699 ng/mL and to human TNFR1 with an EC50 of 4.409-6.797 ng/mL. |
| Molecular Weight | 20.8 kDa |
| Source / Origin | Human protein produced in Mammalian cell. |
| pH Range / Optimal pH | pH 8.0 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA and LTA receptor-binding studies. |
| Recommended Buffer System | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | LT-alpha; TNF-beta; TNFB; TNFSF1 |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | N-terminal 6xHis tag |
| Amino Acid Sequence | LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| UniProt Accession | P01374 |
| Protein Length | 171 aa |
| Expression Region | 35-205 aa |
| Endotoxin Level | <1.0 EU/ug as determined by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
