- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human IGF-Like Family Receptor 1 (IGFLR1), Partial, 6xHis Tag, Active |
| Catalog No. | PTR-HMM-0260 |
| Description | An active recombinant human IGFLR1 extracellular fragment spanning residues 23-163, produced in mammalian cells with a C-terminal 6xHis tag. The protein is purified to at least 95% and retains measurable binding to human IGFL1. |
| Intended Use | Suitable for IGFLR1-IGFL1 interaction studies, functional ELISA, receptor binding analysis, and antibody screening research. |
| Principle / Technology | The IGFLR1 extracellular domain is expressed in mammalian cells, purified through its affinity tag, and assessed by ligand-binding ELISA. |
| Detection Method | SDS-PAGE; functional ELISA; LAL assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=95% by SDS-PAGE. EC50: 32.33-47.52 ng/mL. Molecular weight: 17.4 kDa. Package sizes: 20 ug; 100 ug; 1 mg. |
| Sensitivity / LOD | EC50: 32.33-47.52 ng/mL. |
| Specificity | Binding activity was demonstrated with human IGFL1. |
| Reaction Conditions / Protocol | Immobilize recombinant human IGFLR1 and evaluate concentration-dependent human IGFL1 binding by functional ELISA. |
| Components / Formulation | PBS, 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity validated by functional testing. |
| Key Features | Active human IGFLR1 extracellular fragment; residues 23-163; C-terminal 6xHis tag; mammalian expression; low endotoxin. |
| Purity | >=95% by SDS-PAGE. |
| Activity / Unit Definition | In a functional ELISA, immobilized human IGFLR1 bound human IGFL1 with an EC50 of 32.33-47.52 ng/mL. |
| Molecular Weight | 17.4 kDa |
| Source / Origin | Human protein produced in Mammalian cells. |
| pH Range / Optimal pH | pH 7.4 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA and IGFLR1-IGFL1 interaction studies. |
| Recommended Buffer System | PBS, 6% trehalose, pH 7.4 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | Transmembrane protein 149; U2 small nuclear RNA auxiliary factor 1-like 4 |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal 6xHis tag |
| Amino Acid Sequence | SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP |
| UniProt Accession | Q9H665 |
| Protein Length | 141 aa |
| Expression Region | 23-163 aa |
| Endotoxin Level | <1.0 EU/ug by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
