- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Growth/Differentiation Factor 6 (GDF6), Active |
| Catalog No. | PTR-HMM-0122 |
| Description | An active recombinant human GDF6 protein representing full length of mature protein, produced using E. coli and purified for functional protein research. |
| Intended Use | For protein interaction studies, antibody evaluation, assay development, functional characterization and related life-science research. |
| Principle / Technology | Recombinant expression using E. coli, followed by purification and functional qualification. |
| Detection Method | ATDC5 alkaline phosphatase induction assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Package options: 10 ug; 100 ug; 500 ug. Purity: >=95% by SDS-PAGE. Functional performance: Biological activity is confirmed by induction of alkaline phosphatase in murine ATDC5 cells, with an ED50 below 2.0 ug/mL and a specific activity above 500 IU/mg. |
| Sensitivity / LOD | ED50: <2.0 ug/mL; specific activity: >500 IU/mg |
| Specificity | Human GDF6 |
| Reaction Conditions / Protocol | Biological activity is confirmed by induction of alkaline phosphatase in murine ATDC5 cells, with an ED50 below 2.0 ug/mL and a specific activity above 500 IU/mg. |
| Components / Formulation | 0.2 um-filtered concentrated solution containing 30% acetonitrile and 0.1% trifluoroacetic acid |
| Storage Conditions | Store at -20 C or -80 C. Prepare working aliquots for repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Liquid: 6 months at -20 C or -80 C. Lyophilized: 12 months at -20 C or -80 C. |
| Package Specifications | 10 ug; 100 ug; 500 ug |
| Product Form | Liquid or lyophilized powder |
| Quality Control | Purity is assessed by the method stated in the specification. Functional performance is qualified by atdc5 alkaline phosphatase induction assay. |
| Key Features | Active recombinant human GDF6; Full length of mature protein; E. coli; >=95% by SDS-PAGE purity; documented functional performance; endotoxin <0.1 EU/ug by LAL assay. |
| Purity | >=95% by SDS-PAGE |
| Activity / Unit Definition | Biological activity is confirmed by induction of alkaline phosphatase in murine ATDC5 cells, with an ED50 below 2.0 ug/mL and a specific activity above 500 IU/mg. |
| Molecular Weight | 13.6 kDa |
| Source / Origin | Human; recombinant production using E. coli. |
| Expiration Date / Stability | Liquid material is stable for 6 months at -20 C or -80 C; lyophilized material is stable for 12 months at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | ATDC5 cell-based bioactivity assay; growth factor research; protein interaction studies |
| Recommended Buffer System | 0.2 um-filtered concentrated solution containing 30% acetonitrile and 0.1% trifluoroacetic acid |
| Application Notes / Precautions | Prepare working aliquots when multiple uses are expected. Avoid repeated freeze-thaw cycles and use aseptic handling practices. |
| Alternative Names / Synonyms | BMP13; GDF16; GDF-6; Bone morphogenetic protein 13; Growth/differentiation factor 6; Growth/differentiation factor 16 |
| Lead Time | 5-10 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | Tag-Free |
| Amino Acid Sequence | TAFASRHGKRHGKKSRLRCSKKPLHVNFKELGWDDWIIAPLEYEAYHCEGVCDFPLRSHLEPTNHAIIQTLMNSMDPGSTPPSCCVPTKLTPISILYIDAGNNVVYKQYEDMVVESCGCR |
| UniProt Accession | Q6KF10 |
| Protein Length | 120 aa |
| Expression Region | 336-455 aa |
| Endotoxin Level | <0.1 EU/ug by LAL assay |
For research use only, not for clinical use.
|
There is no product in your cart. |