Recombinant Human Growth/Differentiation Factor 5 (GDF5), Active
Research
Online Inquiry

Recombinant Human Growth/Differentiation Factor 5 (GDF5), Active

Cat.No: PTR-HMM-0123 Datasheet

Quantities:
- +
Product Details Related Products
Product Name Recombinant Human Growth/Differentiation Factor 5 (GDF5), Active
Catalog No. PTR-HMM-0123
Description An active recombinant human GDF5 protein representing full length of mature protein, produced using E. coli and purified for functional protein research.
Intended Use For protein interaction studies, antibody evaluation, assay development, functional characterization and related life-science research.
Principle / Technology Recombinant expression using E. coli, followed by purification and functional qualification.
Detection Method ATDC5 alkaline phosphatase induction assay
Sample Type Purified recombinant protein
Performance Range / Specifications Package options: 10 ug; 100 ug; 500 ug. Purity: >=95% by SDS-PAGE. Functional performance: Biological activity is confirmed by induction of alkaline phosphatase in murine ATDC5 cells, with an ED50 below 1.0 ug/mL and a specific activity above 1,000 IU/mg.
Sensitivity / LOD ED50: <1.0 ug/mL; specific activity: >1,000 IU/mg
Specificity Human GDF5
Reaction Conditions / Protocol Biological activity is confirmed by induction of alkaline phosphatase in murine ATDC5 cells, with an ED50 below 1.0 ug/mL and a specific activity above 1,000 IU/mg.
Components / Formulation 0.2 um-filtered concentrated solution containing 30% acetonitrile and 0.1% trifluoroacetic acid
Storage Conditions Store at -20 C or -80 C. Prepare working aliquots for repeated use and avoid repeated freeze-thaw cycles.
Shelf Life Liquid: 6 months at -20 C or -80 C. Lyophilized: 12 months at -20 C or -80 C.
Package Specifications 10 ug; 100 ug; 500 ug
Product Form Liquid or lyophilized powder
Quality Control Purity is assessed by the method stated in the specification. Functional performance is qualified by atdc5 alkaline phosphatase induction assay.
Key Features Active recombinant human GDF5; Full length of mature protein; E. coli; >=95% by SDS-PAGE purity; documented functional performance; endotoxin <0.1 EU/ug by LAL assay.
Purity >=95% by SDS-PAGE
Activity / Unit Definition Biological activity is confirmed by induction of alkaline phosphatase in murine ATDC5 cells, with an ED50 below 1.0 ug/mL and a specific activity above 1,000 IU/mg.
Molecular Weight 13.6 kDa
Source / Origin Human; recombinant production using E. coli.
Expiration Date / Stability Liquid material is stable for 6 months at -20 C or -80 C; lyophilized material is stable for 12 months at -20 C or -80 C.
Regulatory / Compliance For research use only; not for clinical diagnosis or treatment.
Compatibility ATDC5 cell-based bioactivity assay; growth factor research; protein interaction studies
Recommended Buffer System 0.2 um-filtered concentrated solution containing 30% acetonitrile and 0.1% trifluoroacetic acid
Application Notes / Precautions Prepare working aliquots when multiple uses are expected. Avoid repeated freeze-thaw cycles and use aseptic handling practices.
Alternative Names / Synonyms BMP14; Cartilage-derived morphogenetic protein 1; CDMP-1; CDMP1; GDF-5; Growth/differentiation factor 5; LAP4; OS5; Radotermin; SYNS2
Lead Time 5-10 business days
Availability Status In Stock
Host Species Human
Tag Information Tag-Free
Amino Acid Sequence APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
UniProt Accession P43026
Protein Length 120 aa
Expression Region 382-501 aa
Endotoxin Level <0.1 EU/ug by LAL assay

For research use only, not for clinical use.

0
0

There is no product in your cart.