- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Ephrin-A5 (EFNA5), Active |
| Catalog No. | PTR-HMM-0159 |
| Description | An active recombinant human EFNA5 construct representing the full-length mature protein (21-203 aa) and produced in mammalian cells. The protein carries a C-terminal hFc1 tag and is supplied for research use. |
| Intended Use | For research use in functional ELISA; LSPR; ephrin-receptor interaction studies. |
| Principle / Technology | Recombinant expression in mammalian cells, followed by purification and functional qualification with sDS-PAGE; functional ELISA; LSPR. |
| Detection Method | SDS-PAGE; functional ELISA; LSPR |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | ≥90% by SDS-PAGE; molecular weight 50.1 kDa; package options: 10 µg; 20 µg; 50 µg; 100 µg; 200 µg; 500 µg; 1 mg. |
| Sensitivity / LOD | EC50 0.8674-1.119 ng/mL; LSPR KD 13.8 nM for EPHA3 binding. |
| Specificity | Binds human EPHA3. |
| Reaction Conditions / Protocol | Use the liquid material as supplied, or briefly centrifuge and reconstitute lyophilized material with sterile deionized water to 0.1-1.0 mg/mL. |
| Components / Formulation | PBS containing 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20°C or -80°C. Prepare working aliquots after opening or reconstitution and avoid repeated freeze-thaw cycles. |
| Shelf Life | Liquid material: up to 6 months at -20°C to -80°C; lyophilized material: up to 12 months at -20°C to -80°C. |
| Package Specifications | 10 µg; 20 µg; 50 µg; 100 µg; 200 µg; 500 µg; 1 mg |
| Product Form | Liquid or lyophilized |
| Quality Control | Purity assessed by SDS-PAGE; functional performance verified in the stated bioassay; endotoxin level <1.0 EU/µg. |
| Key Features | Functionally tested active protein; defined 21-203 aa construct; C-terminal hFc1 tag; ≥90% by SDS-PAGE. |
| Purity | ≥90% by SDS-PAGE |
| Activity / Unit Definition | Functional ELISA confirmed binding to human EPHA3 with an EC50 of 0.8674-1.119 ng/mL. LSPR analysis measured a KD of 13.8 nM. |
| Molecular Weight | 50.1 kDa |
| Source / Origin | Human protein produced in mammalian cells. |
| pH Range / Optimal pH | pH 7.4 |
| Expiration Date / Stability | Liquid material: up to 6 months at -20°C to -80°C; lyophilized material: up to 12 months at -20°C to -80°C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Functional ELISA; LSPR; ephrin-receptor interaction studies |
| Recommended Buffer System | PBS containing 6% trehalose, pH 7.4 |
| Application Notes / Precautions | For long-term use, store in working aliquots and avoid repeated freeze-thaw cycles. Reconstituted working material may be kept at 4°C for up to one week. |
| Alternative Names / Synonyms | Ephrin-A5; LERK7; RAGS |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal hFc1 tag |
| Amino Acid Sequence | QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN |
| UniProt Accession | P52803 |
| Protein Length | 183 amino acids |
| Expression Region | 21-203 aa |
| Endotoxin Level | <1.0 EU/µg |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
