- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Endothelin-1 Receptor (EDNRA) VLPs, Active |
| Catalog No. | PTR-HMM-0269 |
| Description | An active human endothelin-1 receptor presented in a mammalian-cell-derived virus-like particle format. The mature full-length receptor region carries a C-terminal 10xHis tag and shows specific antibody binding by functional ELISA. |
| Intended Use | Suitable for EDNRA antibody screening, functional ELISA, endothelin receptor research, and VLP-based membrane-protein assays. |
| Principle / Technology | Full-length membrane protein is expressed in mammalian cells and presented in a virus-like particle format that preserves a membrane-associated antigenic conformation for binding analysis. |
| Detection Method | SEC-HPLC; functional ELISA; anti-His immunodetection; LAL assay |
| Sample Type | Purified recombinant VLP preparation |
| Performance Range / Specifications | Purity: >=95% by SEC-HPLC. EC50: 2.225-3.570 ng/mL. Molecular weight: 47.9 kDa. Package sizes: 20 ug; 100 ug; 1 mg. |
| Sensitivity / LOD | EC50: 2.225-3.570 ng/mL. |
| Specificity | Binding activity was demonstrated with an EDNRA-specific recombinant antibody. |
| Reaction Conditions / Protocol | Immobilize human EDNRA VLPs at 10 ug/mL and measure binding to an EDNRA-specific recombinant antibody by functional ELISA. |
| Components / Formulation | PBS, 0.2 M arginine, 6% trehalose |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SEC-HPLC; endotoxin tested by LAL assay; biological activity validated by functional testing. |
| Key Features | Active human EDNRA VLPs; mature receptor residues 21-427; C-terminal 10xHis tag; >=95% by SEC-HPLC; mammalian expression; low endotoxin. |
| Purity | >=95% by SEC-HPLC. |
| Activity / Unit Definition | In a functional ELISA, immobilized human EDNRA at 10 ug/mL bound an EDNRA-specific recombinant antibody with an EC50 of 2.225-3.570 ng/mL. |
| Molecular Weight | 47.9 kDa |
| Source / Origin | Human protein produced in Mammalian cells. |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA, membrane receptor antibody-binding studies, and VLP-based assay development. |
| Recommended Buffer System | PBS, 0.2 M arginine, 6% trehalose |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | Endothelin-1 receptor; Endothelin receptor type A; ETA; ETRA |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal 10xHis tag |
| Amino Acid Sequence | DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN |
| UniProt Accession | P25101 |
| Protein Length | 407 aa |
| Expression Region | 21-427 aa |
| Endotoxin Level | <1.0 EU/ug by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
