- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Delta-Like Protein 3 (DLL3), Partial, Active |
| Catalog No. | PTR-HMM-0227 |
| Description | A recombinant human DLL3 extracellular region spanning residues 27-492, produced in mammalian cells with a C-terminal 6xHis tag. Antibody-binding activity was confirmed by functional ELISA. |
| Intended Use | Suitable for functional ELISA, antibody-binding studies, DLL3-targeted oncology research, and biomarker evaluation. |
| Principle / Technology | A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays. |
| Detection Method | SDS-PAGE; functional ELISA; LAL assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=85% by SDS-PAGE. Molecular weight: 51.5 kDa. Package sizes: 20 ug; 100 ug; 1 mg. |
| Sensitivity / LOD | Functional ELISA EC50: 1.102-1.707 ng/mL for binding to an anti-DLL3 recombinant antibody. |
| Specificity | Binding activity was demonstrated with an anti-DLL3 recombinant antibody. |
| Reaction Conditions / Protocol | In a functional ELISA, immobilized human DLL3 at 2 ug/mL bound an anti-DLL3 recombinant antibody, with an EC50 of 1.102-1.707 ng/mL. |
| Components / Formulation | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE; endotoxin tested by LAL assay; biological activity verified by functional ELISA. |
| Key Features | Active human DLL3 extracellular region; 27-492 aa; C-terminal 6xHis tag; mammalian cell expression. |
| Purity | >=85% by SDS-PAGE. |
| Activity / Unit Definition | In a functional ELISA, immobilized human DLL3 at 2 ug/mL bound an anti-DLL3 recombinant antibody, with an EC50 of 1.102-1.707 ng/mL. |
| Molecular Weight | 51.5 kDa |
| Source / Origin | Human protein produced in mammalian cells. |
| pH Range / Optimal pH | pH 8.0 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA and DLL3 antibody-binding studies. |
| Recommended Buffer System | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | Drosophila Delta homolog 3; Delta3 |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal 6xHis tag |
| Amino Acid Sequence | AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL |
| UniProt Accession | Q9NYJ7 |
| Protein Length | 466 aa |
| Expression Region | 27-492 aa |
| Endotoxin Level | <1.0 EU/ug by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |