- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Cytotoxic T-Lymphocyte Protein 4 (CTLA4/CD152), Partial, Active |
| Catalog No. | PTR-HMM-0170 |
| Description | Human CTLA4 extracellular segment spanning residues 37-162, expressed in mammalian cells with a C-terminal hFc1 tag. The protein is supplied in an active form and validated for anti-CD152 antibody binding. |
| Intended Use | Functional ELISA, immune checkpoint research, antibody-binding studies, and assay development. |
| Principle / Technology | A defined recombinant protein region is expressed and purified, then its structural integrity and target-binding function are evaluated using the listed biochemical binding assays. |
| Detection Method | SDS-PAGE; SEC-HPLC; functional ELISA |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | >=90% by SDS-PAGE; >=90% by SEC-HPLC; calculated molecular weight 42.5 kDa; package options: 20 ug; 100 ug; 1 mg. |
| Sensitivity / LOD | In functional ELISA, immobilized CTLA4 bound an anti-CD152 antibody with an EC50 of 27.14-34.82 ng/mL. |
| Specificity | Recognized by an antibody directed against human CTLA4/CD152. |
| Reaction Conditions / Protocol | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. |
| Components / Formulation | Tris- or PBS-based buffer containing 6% trehalose before lyophilization |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE and SEC-HPLC; endotoxin tested by LAL assay; biological activity verified by functional ELISA. |
| Key Features | Active Human recombinant protein; 37-162 aa expression region; Mammalian cell expression; C-terminal hFc1 tag; >=90% by SDS-PAGE; >=90% by SEC-HPLC; low endotoxin. |
| Purity | >=90% by SDS-PAGE; >=90% by SEC-HPLC |
| Activity / Unit Definition | In functional ELISA, immobilized CTLA4 bound an anti-CD152 antibody with an EC50 of 27.14-34.82 ng/mL. |
| Molecular Weight | 42.5 kDa |
| Source / Origin | Human protein produced in Mammalian cell. |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Functional ELISA, immune checkpoint research, antibody-binding studies, and assay development. |
| Recommended Buffer System | Tris- or PBS-based buffer containing 6% trehalose before lyophilization |
| Application Notes / Precautions | Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | CTLA4; CD152; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152 |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal hFc1 tag |
| Amino Acid Sequence | AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF |
| UniProt Accession | P16410 |
| Protein Length | 126 amino acids |
| Expression Region | 37-162 aa |
| Endotoxin Level | <1.0 EU/ug by LAL assay |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
