- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Cystine/Glutamate Transporter (SLC7A11/xCT), Full Length, Active |
| Catalog No. | PTR-HMM-0225 |
| Description | A full-length recombinant human SLC7A11 membrane transporter spanning residues 1-501, produced using an in vitro E. coli expression system with an N-terminal 10xHis tag. Antibody binding was characterized by functional ELISA and bio-layer interferometry. |
| Intended Use | Suitable for functional ELISA, high-affinity antibody-binding studies, membrane transporter research, and SLC7A11/xCT target evaluation. |
| Principle / Technology | A defined recombinant protein region is expressed and purified, then its structural quality and biological function are evaluated using the listed biochemical binding or activity assays. |
| Detection Method | SDS-PAGE; functional ELISA; bio-layer interferometry |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=90% by SDS-PAGE. Molecular weight: 58.2 kDa. Package sizes: 20 ug; 100 ug. |
| Sensitivity / LOD | Functional ELISA EC50: 9.452-13.79 ng/mL; bio-layer interferometry affinity constant: <1 pM. |
| Specificity | Binding activity was demonstrated with an anti-human SLC7A11 antibody. |
| Reaction Conditions / Protocol | In a functional ELISA, immobilized human SLC7A11 at 2 ug/mL bound an anti-SLC7A11 recombinant antibody with an EC50 of 9.452-13.79 ng/mL. Bio-layer interferometry showed antibody binding with an affinity constant below 1 pM. |
| Components / Formulation | Liquid format: Tris- or PBS-based buffer with 5%-50% glycerol. Lyophilized format: Tris- or PBS-based buffer with 6% trehalose. |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug |
| Product Form | Liquid or lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE; antibody binding verified by functional ELISA and bio-layer interferometry. |
| Key Features | Active full-length human SLC7A11; 1-501 aa; N-terminal 10xHis tag; membrane protein format. |
| Purity | >=90% by SDS-PAGE. |
| Activity / Unit Definition | In a functional ELISA, immobilized human SLC7A11 at 2 ug/mL bound an anti-SLC7A11 recombinant antibody with an EC50 of 9.452-13.79 ng/mL. Bio-layer interferometry showed antibody binding with an affinity constant below 1 pM. |
| Molecular Weight | 58.2 kDa |
| Source / Origin | Human protein produced using an in vitro E. coli expression system. |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA, bio-layer interferometry, and SLC7A11 antibody-binding studies. |
| Recommended Buffer System | Tris- or PBS-based buffer; glycerol for liquid format or 6% trehalose for lyophilized format. |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | Amino acid transport system xc-; Calcium channel blocker resistance protein CCBR1; Solute carrier family 7 member 11; xCT |
| Lead Time | Contact local distributor; delivery time varies by purchasing method and destination. |
| Host Species | Human |
| Tag Information | N-terminal 10xHis tag |
| Amino Acid Sequence | MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL |
| UniProt Accession | Q9UPY5 |
| Protein Length | 501 aa |
| Expression Region | 1-501 aa |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
