- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human CD276 Antigen, Partial (Active) |
| Catalog No. | PTR-HMM-0114 |
| Description | An active recombinant human CD276 protein representing partial, produced in Mammalian cells and purified for protein interaction, antibody-binding and cell-research workflows. |
| Intended Use | For protein interaction studies, antibody evaluation, assay development and related life-science research. |
| Principle / Technology | Recombinant expression in Mammalian cells followed by protein purification and functional qualification. |
| Detection Method | ELISA binding assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Package options: 20 ug; 100 ug; 1 mg. Purity: >90% by SDS-PAGE. Functional performance: Immobilized human CD276 at 2 ug/mL binds an anti-CD276 rabbit monoclonal antibody with an EC50 of 1.961-2.243 ng/mL. |
| Sensitivity / LOD | EC50: 1.961-2.243 ng/mL |
| Specificity | Human CD276 |
| Reaction Conditions / Protocol | Immobilized human CD276 at 2 ug/mL binds an anti-CD276 rabbit monoclonal antibody with an EC50 of 1.961-2.243 ng/mL. |
| Components / Formulation | PBS containing 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20 C or -80 C. Prepare working aliquots when multiple uses are expected and avoid repeated freeze-thaw cycles. |
| Shelf Life | Liquid: 6 months at -20 C or -80 C. Lyophilized: 12 months at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Liquid or lyophilized powder |
| Quality Control | Purity assessed by SDS-PAGE. Functional activity qualified by elisa binding assay. |
| Key Features | Active recombinant human CD276; Partial; Mammalian cells expression; >90% by SDS-PAGE purity; defined functional activity; endotoxin <1.0 EU/ug by LAL assay. |
| Purity | >90% by SDS-PAGE |
| Activity / Unit Definition | Immobilized human CD276 at 2 ug/mL binds an anti-CD276 rabbit monoclonal antibody with an EC50 of 1.961-2.243 ng/mL. |
| Molecular Weight | 53.4 kDa |
| Source / Origin | Human; recombinant expression in Mammalian cells. |
| pH Range / Optimal pH | 7.4 |
| Shipping Conditions | Shipped with blue ice packs; dry-ice shipment may be arranged when required. |
| Expiration Date / Stability | Liquid material is stable for 6 months at -20 C or -80 C; lyophilized material is stable for 12 months at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Protein interaction assays; antibody-binding assays; assay development; biochemical research |
| Recommended Buffer System | PBS containing 6% trehalose, pH 7.4 |
| Application Notes / Precautions | Avoid repeated freeze-thaw cycles. For multiple uses, divide the material into working aliquots. Liquid material may be held at 4 C for up to one week during active use. |
| Alternative Names / Synonyms | CD276; B7-H3; B7 homolog 3; B7RP-2; CD276 antigen |
| Lead Time | 1-3 working days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal Fc-Myc-tagged |
| Amino Acid Sequence | LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG |
| UniProt Accession | Q5ZPR3 |
| Protein Length | 217 aa |
| Expression Region | 29-245 aa |
| Endotoxin Level | <1.0 EU/ug by LAL assay |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
