- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human CD226 Antigen, Partial, Active |
| Catalog No. | PTR-HMM-0139 |
| Description | An active recombinant human CD226 protein representing partial, produced using Mammalian cells and purified for functional protein research. |
| Intended Use | For protein interaction studies, antibody evaluation, assay development, functional characterization and related life-science research. |
| Principle / Technology | Recombinant expression using Mammalian cells, followed by purification and functional qualification. |
| Detection Method | Flow-cytometric cell-binding assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Package options: 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg. Purity: >=90% by SDS-PAGE. Functional performance: The recombinant protein binds 293F cells overexpressing human CD155 in a flow-cytometric binding assay. |
| Sensitivity / LOD | Qualitative FACS binding to CD155-overexpressing 293F cells |
| Specificity | Human CD226 |
| Reaction Conditions / Protocol | The recombinant protein binds 293F cells overexpressing human CD155 in a flow-cytometric binding assay. |
| Components / Formulation | PBS containing 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20 C or -80 C. Prepare working aliquots for repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Liquid: 6 months at -20 C or -80 C. Lyophilized: 12 months at -20 C or -80 C. |
| Package Specifications | 10 ug; 20 ug; 50 ug; 100 ug; 200 ug; 500 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity is assessed by the method stated in the specification. Functional performance is qualified by flow-cytometric cell-binding assay. |
| Key Features | Active recombinant human CD226; Partial; Mammalian cells; >=90% by SDS-PAGE purity; documented functional performance; endotoxin <1.0 EU/ug by LAL assay. |
| Purity | >=90% by SDS-PAGE |
| Activity / Unit Definition | The recombinant protein binds 293F cells overexpressing human CD155 in a flow-cytometric binding assay. |
| Molecular Weight | 56.1 kDa |
| Source / Origin | Human; recombinant production using Mammalian cells. |
| pH Range / Optimal pH | 7.4 |
| Expiration Date / Stability | Liquid material is stable for 6 months at -20 C or -80 C; lyophilized material is stable for 12 months at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | FACS; CD155-expressing cell binding; immune receptor-ligand research |
| Recommended Buffer System | PBS containing 6% trehalose, pH 7.4 |
| Application Notes / Precautions | Briefly centrifuge lyophilized material before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL. For extended storage after reconstitution, add glycerol to a final concentration of 5%-50%, prepare working aliquots and avoid repeated freeze-thaw cycles. Working aliquots may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | CD226 antigen; CD226; DNAM-1; DNAM1 |
| Lead Time | 3-7 working days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal human Fc1-Myc-tagged |
| Amino Acid Sequence | EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDN |
| UniProt Accession | Q15762 |
| Protein Length | 229 aa |
| Expression Region | 19-247 aa |
| Endotoxin Level | <1.0 EU/ug by LAL assay |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
