- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human C-Type Lectin Domain Family 4 Member C (CLEC4C/CD303), Partial, Active |
| Catalog No. | PTR-HMM-0148 |
| Description | An active recombinant human CLEC4C construct representing the partial extracellular region (45-213 aa) and produced in E. coli. The protein carries a N-terminal 6×His-SUMO tag and is supplied for research use. |
| Intended Use | For research use in functional ELISA; antibody characterization. |
| Principle / Technology | Recombinant expression in E. coli, followed by purification and functional qualification with sDS-PAGE; functional ELISA. |
| Detection Method | SDS-PAGE; functional ELISA |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | >90% by SDS-PAGE; molecular weight 36.0 kDa; package options: 20 µg; 100 µg; 1 mg. |
| Sensitivity / LOD | EC50 31.43-43.52 µg/mL for antibody binding. |
| Specificity | Recognized by anti-human CLEC4C antibodies. |
| Reaction Conditions / Protocol | Use the liquid material as supplied, or briefly centrifuge and reconstitute lyophilized material with sterile deionized water to 0.1-1.0 mg/mL. |
| Components / Formulation | Tris-based buffer containing 50% glycerol |
| Storage Conditions | Store at -20°C or -80°C. Prepare working aliquots after opening or reconstitution and avoid repeated freeze-thaw cycles. |
| Shelf Life | Liquid material: up to 6 months at -20°C to -80°C; lyophilized material: up to 12 months at -20°C to -80°C. |
| Package Specifications | 20 µg; 100 µg; 1 mg |
| Product Form | Liquid or lyophilized |
| Quality Control | Purity assessed by SDS-PAGE; functional performance verified in the stated bioassay. |
| Key Features | Functionally tested active protein; defined 45-213 aa construct; N-terminal 6×His-SUMO tag; >90% by SDS-PAGE. |
| Purity | >90% by SDS-PAGE |
| Activity / Unit Definition | Functional ELISA confirmed recognition by a human CLEC4C antibody with an EC50 of 31.43-43.52 µg/mL. |
| Molecular Weight | 36.0 kDa |
| Source / Origin | Human protein produced in E. coli. |
| Expiration Date / Stability | Liquid material: up to 6 months at -20°C to -80°C; lyophilized material: up to 12 months at -20°C to -80°C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Functional ELISA; antibody characterization |
| Recommended Buffer System | Tris-based buffer containing 50% glycerol |
| Application Notes / Precautions | For long-term use, store in working aliquots and avoid repeated freeze-thaw cycles. Reconstituted working material may be kept at 4°C for up to one week. |
| Alternative Names / Synonyms | BDCA2; CLECSF11; CD303 |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | N-terminal 6×His-SUMO tag |
| Amino Acid Sequence | NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI |
| UniProt Accession | Q8WTT0 |
| Protein Length | 169 amino acids |
| Expression Region | 45-213 aa |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
