Recombinant Human C-C Chemokine Receptor Type 5 (CCR5/CD195) VLPs, Active
Research
Online Inquiry

Recombinant Human C-C Chemokine Receptor Type 5 (CCR5/CD195) VLPs, Active

Cat.No: PTR-HMM-0266 Datasheet

Quantities:
- +
Product Details Related Products
Product Name Recombinant Human C-C Chemokine Receptor Type 5 (CCR5/CD195) VLPs, Active
Catalog No. PTR-HMM-0266
Description A full-length active human CCR5 membrane protein displayed in a mammalian-cell-derived virus-like particle format. The preparation is assessed by SEC-HPLC and demonstrates specific antibody binding by functional ELISA.
Intended Use Suitable for CCR5 antibody screening, functional ELISA, chemokine receptor research, and membrane-protein assay development.
Principle / Technology Full-length membrane protein is expressed in mammalian cells and presented in a virus-like particle format that preserves a membrane-associated antigenic conformation for binding analysis.
Detection Method SEC-HPLC; functional ELISA; anti-His immunodetection under denaturing conditions; LAL assay
Sample Type Purified recombinant VLP preparation
Performance Range / Specifications Purity: >=95% by SEC-HPLC. EC50: 1.099-1.287 ng/mL. Molecular weight: 42.3 kDa. Package sizes: 20 ug; 100 ug; 1 mg.
Sensitivity / LOD EC50: 1.099-1.287 ng/mL.
Specificity Binding activity was demonstrated with a CCR5-specific recombinant antibody.
Reaction Conditions / Protocol Immobilize human CCR5 VLPs at 10 ug/mL and measure binding to a CCR5-specific recombinant antibody by functional ELISA.
Components / Formulation PBS, 6% trehalose, pH 7.4
Storage Conditions Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles.
Shelf Life Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Package Specifications 20 ug; 100 ug; 1 mg
Product Form Lyophilized powder
Quality Control Purity evaluated by SEC-HPLC; endotoxin tested by LAL assay; biological activity validated by functional testing.
Key Features Active full-length human CCR5 VLPs; 352 aa; C-terminal 10xHis tag; >=95% by SEC-HPLC; mammalian expression; low endotoxin.
Purity >=95% by SEC-HPLC.
Activity / Unit Definition In a functional ELISA, immobilized human CCR5 at 10 ug/mL bound a CCR5-specific recombinant antibody with an EC50 of 1.099-1.287 ng/mL.
Molecular Weight 42.3 kDa
Source / Origin Human protein produced in Mammalian cells.
pH Range / Optimal pH pH 7.4
Expiration Date / Stability Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C.
Regulatory / Compliance For research use only; not for clinical diagnosis or treatment.
Compatibility Suitable for functional ELISA, membrane receptor antibody-binding studies, and VLP-based assay development.
Recommended Buffer System PBS, 6% trehalose, pH 7.4
Application Notes / Precautions Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week.
Alternative Names / Synonyms C-C CKR-5; CC-CKR-5; CCR-5; CHEMR13; HIV-1 fusion coreceptor; CD195
Lead Time 3-7 business days
Availability Status In Stock
Host Species Human
Tag Information C-terminal 10xHis tag; detectable under denaturing conditions
Amino Acid Sequence MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
UniProt Accession P51681
Protein Length 352 aa
Expression Region 1-352 aa
Endotoxin Level <1.0 EU/ug by the LAL method.

For research use only, not for clinical use.

0
0

There is no product in your cart.