- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human C-C Chemokine Receptor Type 5 (CCR5/CD195) VLPs, Active |
| Catalog No. | PTR-HMM-0266 |
| Description | A full-length active human CCR5 membrane protein displayed in a mammalian-cell-derived virus-like particle format. The preparation is assessed by SEC-HPLC and demonstrates specific antibody binding by functional ELISA. |
| Intended Use | Suitable for CCR5 antibody screening, functional ELISA, chemokine receptor research, and membrane-protein assay development. |
| Principle / Technology | Full-length membrane protein is expressed in mammalian cells and presented in a virus-like particle format that preserves a membrane-associated antigenic conformation for binding analysis. |
| Detection Method | SEC-HPLC; functional ELISA; anti-His immunodetection under denaturing conditions; LAL assay |
| Sample Type | Purified recombinant VLP preparation |
| Performance Range / Specifications | Purity: >=95% by SEC-HPLC. EC50: 1.099-1.287 ng/mL. Molecular weight: 42.3 kDa. Package sizes: 20 ug; 100 ug; 1 mg. |
| Sensitivity / LOD | EC50: 1.099-1.287 ng/mL. |
| Specificity | Binding activity was demonstrated with a CCR5-specific recombinant antibody. |
| Reaction Conditions / Protocol | Immobilize human CCR5 VLPs at 10 ug/mL and measure binding to a CCR5-specific recombinant antibody by functional ELISA. |
| Components / Formulation | PBS, 6% trehalose, pH 7.4 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SEC-HPLC; endotoxin tested by LAL assay; biological activity validated by functional testing. |
| Key Features | Active full-length human CCR5 VLPs; 352 aa; C-terminal 10xHis tag; >=95% by SEC-HPLC; mammalian expression; low endotoxin. |
| Purity | >=95% by SEC-HPLC. |
| Activity / Unit Definition | In a functional ELISA, immobilized human CCR5 at 10 ug/mL bound a CCR5-specific recombinant antibody with an EC50 of 1.099-1.287 ng/mL. |
| Molecular Weight | 42.3 kDa |
| Source / Origin | Human protein produced in Mammalian cells. |
| pH Range / Optimal pH | pH 7.4 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA, membrane receptor antibody-binding studies, and VLP-based assay development. |
| Recommended Buffer System | PBS, 6% trehalose, pH 7.4 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | C-C CKR-5; CC-CKR-5; CCR-5; CHEMR13; HIV-1 fusion coreceptor; CD195 |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal 10xHis tag; detectable under denaturing conditions |
| Amino Acid Sequence | MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL |
| UniProt Accession | P51681 |
| Protein Length | 352 aa |
| Expression Region | 1-352 aa |
| Endotoxin Level | <1.0 EU/ug by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |