Recombinant Human Atypical Chemokine Receptor 1 (ACKR1/DARC), Active
Research
Online Inquiry

Recombinant Human Atypical Chemokine Receptor 1 (ACKR1/DARC), Active

Cat.No: PTR-HMM-0150 Datasheet

Quantities:
- +
Product Details Related Products
Product Name Recombinant Human Atypical Chemokine Receptor 1 (ACKR1/DARC), Active
Catalog No. PTR-HMM-0150
Description An active recombinant human ACKR1 construct representing the full-length protein (1-336 aa) and produced in an in vitro E. coli expression system. The protein carries a N-terminal 10×His tag and is supplied for research use.
Intended Use For research use in functional ELISA; chemokine-receptor interaction studies.
Principle / Technology Recombinant expression in an in vitro E. coli expression system, followed by purification and functional qualification with sDS-PAGE; functional ELISA.
Detection Method SDS-PAGE; functional ELISA
Sample Type Purified recombinant protein
Performance Range / Specifications ≥85% by SDS-PAGE; molecular weight 41.1 kDa; package options: 20 µg; 100 µg.
Sensitivity / LOD EC50 48.64-60.24 µg/mL for CCL2 binding.
Specificity Binds human CCL2.
Reaction Conditions / Protocol Use the liquid material as supplied, or briefly centrifuge and reconstitute lyophilized material with sterile deionized water to 0.1-1.0 mg/mL.
Components / Formulation Tris-based buffer containing 50% glycerol
Storage Conditions Store at -20°C or -80°C. Prepare working aliquots after opening or reconstitution and avoid repeated freeze-thaw cycles.
Shelf Life Liquid material: up to 6 months at -20°C to -80°C; lyophilized material: up to 12 months at -20°C to -80°C.
Package Specifications 20 µg; 100 µg
Product Form Liquid or lyophilized
Quality Control Purity assessed by SDS-PAGE; functional performance verified in the stated bioassay.
Key Features Functionally tested active protein; defined 1-336 aa construct; N-terminal 10×His tag; ≥85% by SDS-PAGE.
Purity ≥85% by SDS-PAGE
Activity / Unit Definition Functional ELISA confirmed binding to human CCL2 with an EC50 of 48.64-60.24 µg/mL.
Molecular Weight 41.1 kDa
Source / Origin Human protein produced in an in vitro E. coli expression system.
Expiration Date / Stability Liquid material: up to 6 months at -20°C to -80°C; lyophilized material: up to 12 months at -20°C to -80°C.
Regulatory / Compliance For research use only; not for clinical diagnosis or treatment.
Compatibility Functional ELISA; chemokine-receptor interaction studies
Recommended Buffer System Tris-based buffer containing 50% glycerol
Application Notes / Precautions For long-term use, store in working aliquots and avoid repeated freeze-thaw cycles. Reconstituted working material may be kept at 4°C for up to one week.
Alternative Names / Synonyms DARC; FY; Duffy antigen/chemokine receptor; CD234
Lead Time 3-7 business days
Availability Status In Stock
Host Species Human
Tag Information N-terminal 10×His tag
Amino Acid Sequence MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
UniProt Accession Q16570
Protein Length 336 amino acids
Expression Region 1-336 aa

For research use only, not for clinical use.

0
0

There is no product in your cart.