- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human ATP-Dependent RNA Helicase DDX19B, Active |
| Catalog No. | PTR-HMM-0149 |
| Description | An active recombinant human DDX19B construct representing the full-length mature protein (2-479 aa) and produced in E. coli. The tag configuration is determined during production. |
| Intended Use | For research use in functional ELISA; protein-interaction studies. |
| Principle / Technology | Recombinant expression in E. coli, followed by purification and functional qualification with sDS-PAGE; functional ELISA. |
| Detection Method | SDS-PAGE; functional ELISA |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | ≥85% by SDS-PAGE; molecular weight 80.8 kDa; package options: 20 µg; 100 µg; 1 mg. |
| Sensitivity / LOD | EC50 17.71-23.15 µg/mL for LCN2 binding. |
| Specificity | Binds human LCN2 in the reported assay. |
| Reaction Conditions / Protocol | Briefly centrifuge the vial before opening, then reconstitute with sterile deionized water to 0.1-1.0 mg/mL. |
| Storage Conditions | Store at -20°C or -80°C. Prepare working aliquots after opening or reconstitution and avoid repeated freeze-thaw cycles. |
| Shelf Life | Lyophilized material: up to 12 months at -20°C to -80°C. |
| Package Specifications | 20 µg; 100 µg; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity assessed by SDS-PAGE; functional performance verified in the stated bioassay. |
| Key Features | Functionally tested active protein; defined 2-479 aa construct; Tag configuration is determined during production; ≥85% by SDS-PAGE. |
| Purity | ≥85% by SDS-PAGE |
| Activity / Unit Definition | Functional ELISA showed binding to human LCN2 with an EC50 of 17.71-23.15 µg/mL. |
| Molecular Weight | 80.8 kDa |
| Source / Origin | Human protein produced in E. coli. |
| Expiration Date / Stability | Lyophilized material: up to 12 months at -20°C to -80°C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Functional ELISA; protein-interaction studies |
| Application Notes / Precautions | After reconstitution, keep a working aliquot at 4°C for no longer than one week. For longer storage, prepare aliquots and avoid repeated freeze-thaw cycles. |
| Alternative Names / Synonyms | DBP5; DDX19; DEAD-box protein 5 |
| Lead Time | Contact for delivery time |
| Availability Status | Discontinued |
| Host Species | Human |
| Tag Information | Tag configuration is determined during production |
| Amino Acid Sequence | ATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN |
| UniProt Accession | Q9UMR2 |
| Protein Length | 478 amino acids |
| Expression Region | 2-479 aa |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
