- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Angiopoietin-2 (ANGPT2), Active |
| Catalog No. | PTR-HMM-0277 |
| Description | An active recombinant mature human angiopoietin-2 protein spanning residues 19-496, expressed in mammalian cells with a C-terminal 10xHis tag. Purity is assessed by SDS-PAGE and SEC-HPLC, and antibody-binding activity is confirmed by functional ELISA. |
| Intended Use | Suitable for ANGPT2 antibody development, functional ELISA, angiogenesis research, endothelial signaling studies, and assay development. |
| Principle / Technology | Mature human ANGPT2 is expressed in mammalian cells, purified, and evaluated for antibody-binding activity by functional ELISA. |
| Detection Method | SDS-PAGE; SEC-HPLC; functional ELISA; LAL assay |
| Sample Type | Purified recombinant protein |
| Performance Range / Specifications | Purity: >=90% by SDS-PAGE and >=90% by SEC-HPLC. EC50: 0.6666-0.8876 ng/mL. Molecular weight: 56.3 kDa. Package sizes: 20 ug; 100 ug; 1 mg. |
| Sensitivity / LOD | EC50: 0.6666-0.8876 ng/mL. |
| Specificity | Binding activity was demonstrated with an ANGPT2-specific recombinant antibody. |
| Reaction Conditions / Protocol | Immobilize human ANGPT2 at 2 ug/mL and measure binding to an ANGPT2-specific recombinant antibody by functional ELISA. |
| Components / Formulation | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Storage Conditions | Store at -20 C or -80 C upon receipt. Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Shelf Life | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Package Specifications | 20 ug; 100 ug; 1 mg |
| Product Form | Lyophilized powder |
| Quality Control | Purity evaluated by SDS-PAGE and SEC-HPLC; endotoxin tested by LAL assay; biological activity validated by functional testing. |
| Key Features | Active mature human ANGPT2; residues 19-496; C-terminal 10xHis tag; purity verified by SDS-PAGE and SEC-HPLC; mammalian expression; low endotoxin. |
| Purity | >=90% by SDS-PAGE and >=90% by SEC-HPLC. |
| Activity / Unit Definition | In a functional ELISA, immobilized human ANGPT2 at 2 ug/mL bound an ANGPT2-specific recombinant antibody with an EC50 of 0.6666-0.8876 ng/mL. |
| Molecular Weight | 56.3 kDa |
| Source / Origin | Human protein produced in Mammalian cells. |
| pH Range / Optimal pH | pH 8.0 |
| Expiration Date / Stability | Typical stability is 6 months for liquid material and 12 months for lyophilized material when stored at -20 C or -80 C. |
| Regulatory / Compliance | For research use only; not for clinical diagnosis or treatment. |
| Compatibility | Suitable for functional ELISA, ANGPT2 antibody-binding studies, angiogenesis research, and endothelial signaling assays. |
| Recommended Buffer System | 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0 |
| Application Notes / Precautions | Briefly centrifuge the vial before opening. Reconstitute with sterile deionized water to 0.1-1.0 mg/mL when applicable. For long-term storage, add 5-50% glycerol as appropriate, divide into aliquots, and freeze. Avoid repeated freezing and thawing. A working aliquot may be kept at 4 C for up to one week. |
| Alternative Names / Synonyms | Angiopoietin-2; ANG-2 |
| Lead Time | 3-7 business days |
| Availability Status | In Stock |
| Host Species | Human |
| Tag Information | C-terminal 10xHis tag |
| Amino Acid Sequence | YNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPYVSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF |
| UniProt Accession | O15123 |
| Protein Length | 478 aa |
| Expression Region | 19-496 aa |
| Endotoxin Level | <1.0 EU/ug by the LAL method. |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
