- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Monkeypox Virus A35R Antigen |
| Catalog No. | IRMID-0007 |
| Description | A recombinant preparation of monkeypox virus a35r protein, supplied as a liquid in PBS with 50% glycerol, pH 7.4. Relative purity is 85% ± 5% by SDS-PAGE. |
| Intended Use | For use as a calibrator or standard in MPXV A35R assay development and evaluation. |
| Principle / Technology | Recombinant antigen supplied as an assay reference material for Monkeypox virus A35R protein. |
| Detection Method | Calibrator or standard |
| Performance Range / Specifications | HEK293 recombinant expression. |
| Specificity | Monkeypox virus A35R protein |
| Components / Formulation | Monkeypox virus A35R protein in PBS with 50% glycerol, pH 7.4. |
| Storage Conditions | Aliquot and store at or below -20°C. Avoid repeated freeze-thaw cycles. |
| Shelf Life | Stable for 18 months at -20°C. |
| Product Form | Liquid protein preparation. |
| Quality Control | Relative purity is determined by SDS-PAGE. |
| Key Features | Assay reference material; hek293 recombinant expression; 85% ± 5% by SDS-PAGE. |
| Purity | 85% ± 5% by SDS-PAGE |
| Source / Origin | HEK293 recombinant expression. |
| pH Range / Optimal pH | pH 7.4 |
| Regulatory / Compliance | For research and further manufacturing use only. |
| Compatibility | Calibrator or standard |
| Recommended Buffer System | PBS with 50% glycerol, pH 7.4 |
| Application Notes / Precautions | Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Alternative Names / Synonyms | Monkeypox virus A35R protein; MPXV A35R |
| Tag Information | Fc-tag |
| Amino Acid Sequence | MMTPENDEEQTSVFSATVYGDKIQGKNKRKRVIGLCIRISMVISLLSMITMSAFLIVRLNQCMSANEAAITDSAVAVAAASSTHRKVASSTTQYDHKESCNGLYYQGSCYILHSDYKSFEDAKANCAAESSTLPNKSDVLTTWLIDYVEDTWGSDGNPITKTTSDYQDSDVSQEVRKYFCT |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
