- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
| Product Name | Recombinant Human Interleukin-8 Antigen |
| Catalog No. | IRMINFL-0013 |
| Description | An E. coli-expressed recombinant human interleukin-8 preparation formulated as a liquid in 20 mM Tris-HCl containing 500 mM NaCl and 50% glycerol at pH 8.0. Relative purity is 85% ± 5% by SDS-PAGE. |
| Intended Use | For use as a calibrator or standard in human interleukin-8 assay development and evaluation. |
| Principle / Technology | Recombinant E. coli-expressed protein supplied as an assay reference material for human interleukin-8. |
| Detection Method | Calibrator or standard |
| Performance Range / Specifications | Recombinant E. coli-expressed protein. |
| Specificity | human interleukin-8 |
| Components / Formulation | a liquid in 20 mM Tris-HCl containing 500 mM NaCl and 50% glycerol, pH 8.0 |
| Storage Conditions | Aliquot and store at or below -20°C. Avoid repeated freeze-thaw cycles. |
| Shelf Life | Stable for one year at -20°C. |
| Product Form | Liquid protein preparation. |
| Quality Control | Relative purity is determined by SDS-PAGE. |
| Key Features | Assay reference material; E. coli-expressed recombinant protein; 85% ± 5% by SDS-PAGE. |
| Purity | 85% ± 5% by SDS-PAGE |
| Source / Origin | Recombinant E. coli-expressed protein. |
| pH Range / Optimal pH | pH 8.0 |
| Compatibility | Calibrator or standard |
| Recommended Buffer System | a liquid in 20 mM Tris-HCl containing 500 mM NaCl and 50% glycerol, pH 8.0 |
| Application Notes / Precautions | Aliquot before repeated use and avoid repeated freeze-thaw cycles. |
| Alternative Names / Synonyms | Interleukin-8; IL-8 |
| Tag Information | His-tag |
| Amino Acid Sequence | AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
