- Home
- IVD
- By Technology Types
- By Diseases Types
- By Product Types
- Research
- Resource
- Distributors
- Company
Cat.No: AMA-0136 Datasheet Instruction for Use
Specification Quantities
Price $1245–2075
| Product Name | Anti-Intrinsic Factor Antibody |
| Catalog No. | AMA-0136 |
| Description | Rabbit polyclonal antibody to Intrinsic Factor for WB and ICC/IF. |
| Host | Rabbit |
| Antibody Type | Polyclonal |
| Form | Liquid |
| Isotype | IgG |
| Conjugate | Un-conjugated |
| Molecular Weight | 45 kDa |
| Purity | Affinity-purified |
| Reconstituted Form | Supplied in phosphate buffered saline, pH 7.3, with 50% glycerol and 0.02% sodium azide. |
| Reactivity | Human, Mouse |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human GIF (NP_005133.2). |
| Sequence | TQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPS |
| Applications | WB, ICC/IF |
| Storage and Transportation | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles. |
For research use only, not for clinical use.
|
There is no product in your cart. |
Copyright © 2026 Alta DiagnoTech. All rights reserved.
